PDB entry 6f2h

View 6f2h on RCSB PDB site
Description: Structure of Protease 1 from Pyrococcus horikoshii co-crystallized in presence of 10 mM Tb-Xo4 and potassium iodide.
Class: hydrolase
Keywords: Tb-Xo4, crystallophore, nucleation, phasing, Protease, HYDROLASE
Deposited on 2017-11-24, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2ha_
  • Chain 'B':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hb_
  • Chain 'C':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hc_
  • Chain 'D':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hd_
  • Chain 'E':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2he_
  • Chain 'F':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hf_
  • Chain 'G':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hg_
  • Chain 'H':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hh_
  • Chain 'I':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hi_
  • Chain 'J':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hj_
  • Chain 'K':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hk_
  • Chain 'L':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2hl_
  • Heterogens: 7MT, IOD, TB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hA (A:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hB (B:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hC (C:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hD (D:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hE (E:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hF (F:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hG (G:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hH (H:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hI (I:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hJ (J:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hK (K:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2hL (L:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk