PDB entry 6f2f

View 6f2f on RCSB PDB site
Description: Crystal structure of Protease 1 from Pyrococcus Horikoshii co-cystallized in presence of 10 mM Tb-Xo4 and ammonium sulfate.
Class: cell cycle
Keywords: Lanthanide complexes, Tb-Xo4, Crystallophore, Phasing, nucleation, CELL CYCLE
Deposited on 2017-11-24, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2fa_
  • Chain 'B':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2fb_
  • Chain 'C':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2fc_
  • Heterogens: 7MT, SO4, TB, 2HA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2fA (A:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2fB (B:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f2fC (C:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk