PDB entry 6f2c

View 6f2c on RCSB PDB site
Description: Methylglyoxal synthase MgsA from Bacillus subtilis
Class: lyase
Keywords: Methylglyoxal Synthase, PROTEIN BINDING, lyase
Deposited on 2017-11-24, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (20-22)
    Domains in SCOPe 2.07: d6f2ca1, d6f2ca2
  • Chain 'B':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2cb1, d6f2cb2
  • Chain 'C':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2cc1, d6f2cc2
  • Chain 'D':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2cd1, d6f2cd2
  • Chain 'E':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2ce1, d6f2ce2
  • Chain 'F':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2cf1, d6f2cf2
  • Chain 'G':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2cg1, d6f2cg2
  • Chain 'H':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2ch1, d6f2ch2
  • Chain 'I':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (20-22)
    Domains in SCOPe 2.07: d6f2ci1, d6f2ci2
  • Chain 'J':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2cj1, d6f2cj2
  • Chain 'K':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2ck1, d6f2ck2
  • Chain 'L':
    Compound: methylglyoxal synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mgsA, ypjF, BSU22480
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42980 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6f2cl1, d6f2cl2
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f2cA (A:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cA (A:)
    ssvmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgpl
    ggdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvr
    tlde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f2cB (B:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cB (B:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    ld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f2cC (C:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cC (C:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    ld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f2cD (D:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cD (D:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    ld
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6f2cE (E:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cE (E:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    ld
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6f2cF (F:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cF (F:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    ld
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6f2cG (G:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cG (G:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    lde
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6f2cH (H:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cH (H:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    ld
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6f2cI (I:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cI (I:)
    ssvmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgpl
    ggdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvr
    tld
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6f2cJ (J:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cJ (J:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    ld
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6f2cK (K:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cK (K:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    ld
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6f2cL (L:)
    maswshpqfekgaetavpnsssvmkialiahdkkkqdmvqfttayrdilknhdlyatgtt
    glkiheatglqierfqsgplggdqqigaliaanaldlviflrdpltaqphepdvsalirl
    cdvysiplatnmgtaeilvrtldegvfefrdllrgeepnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2cL (L:)
    svmkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplg
    gdqqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrt
    ld