PDB entry 6f0p

View 6f0p on RCSB PDB site
Description: Botulinum neurotoxin A4 Hc domain
Class: toxin
Keywords: botulinum neurotoxin A4 subtype, A4, binding domain, Hc domain, TOXIN
Deposited on 2017-11-20, released 2018-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f0pa1, d6f0pa2
  • Heterogens: NI, PEG, EDO, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f0pA (A:)
    mhhhhhhknitnasilsivykdddlidlsrygaeiyngdkvyynsidknqirlinlesst
    ievilkkaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygei
    iwtfqdtqeikqrvvfkysqminisdyinrwifvtitnnritkskiyingrlidqkpisn
    lgnihasnkimfkldgcrdphryivikyfnlfdkelsekeikdlydnqsnsgilkdfwgd
    ylqydksyymlnlydpnkyvdvnnvgirgymylkgprdnvmttniylnsslymgtkfiik
    kyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvm
    kskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswe
    fipvddgwrerpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f0pA (A:)
    itnasilsivylidlsrygaeiyngdkvyynsidknqirlinlesstievilkkaivyns
    myenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtfqdtqeikqr
    vvfkysqminisdyinrwifvtitnnritkskiyingrlidqkpisnlgnihasnkimfk
    ldgcrdphryivikyfnlfdkelsekeikdlydnqsnsgilkdfwgdylqydksyymlnl
    ydpnkyvdvnnvgirgymylkgprdnvmttniylnsslymgtkfiikkyasgnkdnivrn
    ndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskndqgitnkck
    mnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswefipvddgwrer