PDB entry 6f0e

View 6f0e on RCSB PDB site
Description: Structure of yeast Sec14p with a picolinamide compound
Class: lipid binding protein
Keywords: Sec14p, lipid transfer protein, chemogenomics, target identification, functional variomics, co-crystal, antifungal, benzamide, picolinamide, lipid binding protein
Deposited on 2017-11-20, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SEC14 cytosolic factor
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SEC14, PIT1, YMR079W, YM9582.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f0ea1, d6f0ea2
  • Heterogens: C8K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f0eA (A:)
    hhhhhhhhmvtqqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfier
    lddstllrflrarkfdvqlakemfencekwrkdygtdtilqdfhydekpliakfypqyyh
    ktdkdgrpvyfeelgavnlhemnkvtseermlknlvweyesvvqyrlpacsraaghlvet
    sctimdlkgisissaysvmsyvreasyisqnyypermgkfyiinapfgfstafrlfkpfl
    dpvtvskifilgssyqkellkqipaenlpvkfggksevdeskgglylsdigpwrdpkyig
    pegeapeafsmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f0eA (A:)
    qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr
    arkfdvqlakemfencekwrkdygtdtilqdfhydekpliakfypqyyhktdkdgrpvyf
    eelgavnlhemnkvtseermlknlvweyesvvqyrlpacsraaghlvetsctimdlkgis
    issaysvmsyvreasyisqnyypermgkfyiinapfgfstafrlfkpfldpvtvskifil
    gssyqkellkqipaenlpvkfggksevdeskgglylsdigpwrdpkyigpegeapeafsm