PDB entry 6eze

View 6eze on RCSB PDB site
Description: The open conformation of E.coli Elongation Factor Tu in complex with GDPNP.
Class: translation
Keywords: Elongation Factor G-protein, TRANSLATION
Deposited on 2017-11-15, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor Tu 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ezea1, d6ezea2, d6ezea3
  • Chain 'B':
    Compound: Elongation factor Tu 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ezeb1, d6ezeb2, d6ezeb3
  • Heterogens: GNP, MG, GOL, SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ezeA (A:)
    mskekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekarg
    itintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehi
    llgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkale
    gdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvg
    eeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtik
    phtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmv
    vtlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ezeA (A:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ezeB (B:)
    mskekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekarg
    itintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehi
    llgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkale
    gdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvg
    eeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtik
    phtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmv
    vtlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ezeB (B:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvls