PDB entry 6ez2

View 6ez2 on RCSB PDB site
Description: Human butyrylcholinesterase carbamylated.
Class: hydrolase
Keywords: Butyrylcholinesterase, rivastigmine analogues, Alzheimer disease, central nervous system, inhibitor., HYDROLASE
Deposited on 2017-11-14, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: BCHE, CHE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06276 (0-526)
      • conflict (195)
    Domains in SCOPe 2.07: d6ez2a_
  • Chain 'B':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: BCHE, CHE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06276 (Start-526)
      • conflict (195)
    Domains in SCOPe 2.07: d6ez2b_
  • Heterogens: NAG, GOL, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ez2A (A:)
    diiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkya
    nsccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgt
    sslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkni
    aafggnpksvtlfgexagaasvslhllspgshslftrailqsgsfnapwavtslyearnr
    tlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdm
    pdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvs
    efgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfe
    hrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpne
    tqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ez2B (B:)
    diiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkya
    nsccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgt
    sslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkni
    aafggnpksvtlfgexagaasvslhllspgshslftrailqsgsfnapwavtslyearnr
    tlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdm
    pdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvs
    efgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfe
    hrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpne
    tqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ez2B (B:)
    iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwdiwnatkyans
    ccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgtss
    lhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkniaa
    fggnpksvtlfgexagaasvslhllspgshslftrailqsgsfnapwavtslyearnrtl
    nlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmpd
    illelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvsef
    gkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfehr
    ssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnetq
    nnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv