PDB entry 6eyp

View 6eyp on RCSB PDB site
Description: X-ray structure of the unliganded uridine phosphorylase from Vibrio cholerae at 1.22A
Class: transferase
Keywords: TRANSFERASE, Rossmann Fold
Deposited on 2017-11-13, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, B2J67_05455, B2J68_05210, B2J71_05165, BFX32_04820, BTY66_05555, CEF09_03900, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eypa_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, B2J67_05455, B2J68_05210, B2J71_05165, BFX32_04820, BTY66_05555, CEF09_03900, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eypb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, B2J67_05455, B2J68_05210, B2J71_05165, BFX32_04820, BTY66_05555, CEF09_03900, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eypc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, B2J67_05455, B2J68_05210, B2J71_05165, BFX32_04820, BTY66_05555, CEF09_03900, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eypd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, B2J67_05455, B2J68_05210, B2J71_05165, BFX32_04820, BTY66_05555, CEF09_03900, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eype_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, B2J67_05455, B2J68_05210, B2J71_05165, BFX32_04820, BTY66_05555, CEF09_03900, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eypf_
  • Heterogens: GOL, NA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eypA (A:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eypA (A:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkmlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eypB (B:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eypB (B:)
    tktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsv
    vvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslh
    fapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqg
    smkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsi
    kvvveaarkmlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eypC (C:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eypC (C:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkmlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6eypD (D:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eypD (D:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkmlk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6eypE (E:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eypE (E:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkmlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6eypF (F:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eypF (F:)
    tktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsv
    vvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslh
    fapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqg
    smkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsi
    kvvveaarkmlk