PDB entry 6eya

View 6eya on RCSB PDB site
Description: Estimation of relative drug-target residence times by random acceleration molecular dynamics simulation
Class: chaperone
Keywords: chaperone protein, ATP binding, chaperone
Deposited on 2017-11-11, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eyaa_
  • Heterogens: C4K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eyaA (A:)
    mpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkir
    yesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafme
    alqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepm
    grgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eyaA (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnaksgtkafmealqagadismigqfgvgfys
    aylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqteylee
    rrikeivkkhsqfigypitlfve