PDB entry 6ey6

View 6ey6 on RCSB PDB site
Description: C-terminal part (residues 315-516) of PorM with the llama nanobody nb130
Class: protein transport
Keywords: Type IV Secretion System (T9SS), nanobody, PROTEIN TRANSPORT
Deposited on 2017-11-10, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T9SS component cytoplasmic membrane protein PorM
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: porM, PGIN_15-9_01458
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: T9SS component cytoplasmic membrane protein PorM
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: porM, PGIN_15-9_01458
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: T9SS component cytoplasmic membrane protein PorM
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: porM, PGIN_15-9_01458
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: T9SS component cytoplasmic membrane protein PorM
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: porM, PGIN_15-9_01458
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: T9SS component cytoplasmic membrane protein PorM
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: porM, PGIN_15-9_01458
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: T9SS component cytoplasmic membrane protein PorM
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: porM, PGIN_15-9_01458
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: T9SS component cytoplasmic membrane protein PorM
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: porM, PGIN_15-9_01458
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: T9SS component cytoplasmic membrane protein PorM
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: porM, PGIN_15-9_01458
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: nb130
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EY6
    Domains in SCOPe 2.07: d6ey6i1, d6ey6i2
  • Chain 'J':
    Compound: nb130
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EY6
    Domains in SCOPe 2.07: d6ey6j1, d6ey6j2
  • Chain 'K':
    Compound: nb130
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EY6
    Domains in SCOPe 2.07: d6ey6k1, d6ey6k2
  • Chain 'L':
    Compound: nb130
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EY6
    Domains in SCOPe 2.07: d6ey6l1, d6ey6l2
  • Chain 'M':
    Compound: nb130
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EY6
    Domains in SCOPe 2.07: d6ey6m1, d6ey6m2
  • Chain 'N':
    Compound: nb130
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EY6
    Domains in SCOPe 2.07: d6ey6n1, d6ey6n2
  • Chain 'O':
    Compound: nb130
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EY6
    Domains in SCOPe 2.07: d6ey6o1, d6ey6o2
  • Chain 'P':
    Compound: nb130
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EY6
    Domains in SCOPe 2.07: d6ey6p1, d6ey6p2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ey6I (I:)
    maqvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsi
    hyadsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkyd
    ywgqgtkvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey6I (I:)
    qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
    adsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydyw
    gqgtkvtvs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6ey6J (J:)
    maqvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsi
    hyadsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkyd
    ywgqgtkvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey6J (J:)
    qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
    adsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydyw
    gqgtkvtvss
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6ey6K (K:)
    maqvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsi
    hyadsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkyd
    ywgqgtkvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey6K (K:)
    qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
    adsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydyw
    gqgtkvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ey6L (L:)
    maqvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsi
    hyadsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkyd
    ywgqgtkvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey6L (L:)
    qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
    adsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydyw
    gqgtkvtvss
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6ey6M (M:)
    maqvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsi
    hyadsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkyd
    ywgqgtkvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey6M (M:)
    qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
    adsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydyw
    gqgtkvtvss
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6ey6N (N:)
    maqvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsi
    hyadsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkyd
    ywgqgtkvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey6N (N:)
    qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
    adsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydyw
    gqgtkvtvs
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6ey6O (O:)
    maqvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsi
    hyadsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkyd
    ywgqgtkvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey6O (O:)
    vqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihya
    dsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydywg
    qgtkvtvss
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6ey6P (P:)
    maqvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsi
    hyadsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkyd
    ywgqgtkvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey6P (P:)
    qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
    adsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydyw
    gqgtkvtvss