PDB entry 6exr

View 6exr on RCSB PDB site
Description: CHEMOTAXIS PROTEIN CHEY FROM Pyrococcus horikoshiI
Class: signaling protein
Keywords: signal transduction protein, signaling protein
Deposited on 2017-11-09, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 120aa long hypothetical chemotaxis protein (CheY)
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: PH0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6exra_
  • Chain 'B':
    Compound: 120aa long hypothetical chemotaxis protein (CheY)
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: PH0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6exrb_
  • Chain 'C':
    Compound: 120aa long hypothetical chemotaxis protein (CheY)
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: PH0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6exrc_
  • Chain 'D':
    Compound: 120aa long hypothetical chemotaxis protein (CheY)
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: PH0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6exrd_
  • Chain 'E':
    Compound: 120aa long hypothetical chemotaxis protein (CheY)
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: PH0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6exre_
  • Chain 'F':
    Compound: 120aa long hypothetical chemotaxis protein (CheY)
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: PH0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6exrf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6exrA (A:)
    marvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemd
    gitavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6exrA (A:)
    arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
    itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6exrB (B:)
    marvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemd
    gitavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6exrB (B:)
    arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
    itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6exrC (C:)
    marvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemd
    gitavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6exrC (C:)
    arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmmdgit
    avkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6exrD (D:)
    marvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemd
    gitavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6exrD (D:)
    arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
    itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6exrE (E:)
    marvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemd
    gitavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6exrE (E:)
    arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmmdgit
    avkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6exrF (F:)
    marvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemd
    gitavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6exrF (F:)
    arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
    itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl