PDB entry 6ex3

View 6ex3 on RCSB PDB site
Description: Staphylococcus aureus superoxide dismutase SodA
Class: oxidoreductase
Keywords: superoxide dismutase, cambialistic, Staphylococcus aureus, oxidoreductase, metalloenzyme
Deposited on 2017-11-07, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, BER48_001496, BN1321_260190, CEJ93_06715, ERS072738_01312, ERS072840_00871, ERS073583_00205, ERS074020_01135, HMPREF3211_01704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ex3a1, d6ex3a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, BER48_001496, BN1321_260190, CEJ93_06715, ERS072738_01312, ERS072840_00871, ERS073583_00205, ERS074020_01135, HMPREF3211_01704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ex3b1, d6ex3b2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, BER48_001496, BN1321_260190, CEJ93_06715, ERS072738_01312, ERS072840_00871, ERS073583_00205, ERS074020_01135, HMPREF3211_01704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ex3c1, d6ex3c2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, BER48_001496, BN1321_260190, CEJ93_06715, ERS072738_01312, ERS072840_00871, ERS073583_00205, ERS074020_01135, HMPREF3211_01704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ex3d1, d6ex3d2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ex3A (A:)
    mafelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanl
    dsvpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadka
    aarfgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyig
    afwnvvnwekvdelynatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ex3A (A:)
    afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanlv
    paniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadkaaar
    fgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyigafw
    nvvnwekvdelynat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ex3B (B:)
    mafelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanl
    dsvpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadka
    aarfgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyig
    afwnvvnwekvdelynatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ex3B (B:)
    afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
    svpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadkaa
    arfgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyiga
    fwnvvnwekvdelynat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ex3C (C:)
    mafelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanl
    dsvpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadka
    aarfgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyig
    afwnvvnwekvdelynatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ex3C (C:)
    afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
    svqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadkaaarfg
    sgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyigafwnv
    vnwekvdelynat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ex3D (D:)
    mafelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanl
    dsvpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadka
    aarfgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyig
    afwnvvnwekvdelynatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ex3D (D:)
    afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
    stavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadkaaarfgsg
    wawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyigafwnvvn
    wekvdelynat