PDB entry 6ex1

View 6ex1 on RCSB PDB site
Description: Crystal structure of human carbonic anhydrase I in complex with the 4-[(3S)-3 benzyl-4-(4-sulfamoylbenzoyl)piperazine -1-carbonyl]benzene-1-sulfonamide inhibitor
Class: lyase
Keywords: lyase
Deposited on 2017-11-07, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ex1a_
  • Chain 'B':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ex1b_
  • Heterogens: ZN, N19, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ex1A (A:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ex1A (A:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ex1B (B:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ex1B (B:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf