PDB entry 6ewe

View 6ewe on RCSB PDB site
Description: Crystal structure of BCII Metallo-beta-lactamase in complex with DZ-308
Class: hydrolase
Keywords: antimicrobial resistance, metallo beta lactamase, inhibitor, hydrolase
Deposited on 2017-11-03, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Bacillus cereus [TaxId:1396]
    Gene: blm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ewea_
  • Heterogens: ZN, SO4, C0W, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eweA (A:)
    sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
    dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
    eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn
    vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eweA (A:)
    ktviknetgtisisqlnknvwvhtelgsavpsnglvlntskglvlvdsswddkltkelie
    mvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqt
    vtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnew
    stsienvlkryrninavvpghgevgdkglllhtldllk