PDB entry 6ewb

View 6ewb on RCSB PDB site
Description: Crystal structure of GII.4 UNSW 2012 P domain in complex with Fab 10E9
Class: viral protein
Keywords: protein-Fab complex, Fab fragment of IgG, norovirus, antibody, VIRAL PROTEIN
Deposited on 2017-11-03, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Norovirus Hu/GII.4/Sydney/NSW0514/2012/AU [TaxId:1241973]
    Database cross-references and differences (RAF-indexed):
    • Uniprot K4LM89 (4-309)
      • expression tag (3)
  • Chain 'B':
    Compound: vp1
    Species: Norovirus Hu/GII.4/Sydney/NSW0514/2012/AU [TaxId:1241973]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vp1
    Species: Norovirus Hu/GII.4/Sydney/NSW0514/2012/AU [TaxId:1241973]
    Database cross-references and differences (RAF-indexed):
    • Uniprot K4LM89 (4-309)
      • expression tag (0-3)
  • Chain 'D':
    Compound: vp1
    Species: Norovirus Hu/GII.4/Sydney/NSW0514/2012/AU [TaxId:1241973]
    Database cross-references and differences (RAF-indexed):
    • Uniprot K4LM89 (4-309)
      • expression tag (1-3)
  • Chain 'E':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EWB (0-End)
  • Chain 'F':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EWB
    Domains in SCOPe 2.07: d6ewbf1, d6ewbf2
  • Chain 'G':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EWB (0-215)
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EWB (0-215)
  • Chain 'I':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EWB (0-End)
    Domains in SCOPe 2.07: d6ewbi1, d6ewbi2
  • Chain 'J':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EWB (0-End)
  • Chain 'K':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EWB (0-End)
    Domains in SCOPe 2.07: d6ewbk1, d6ewbk2
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EWB
    Domains in SCOPe 2.07: d6ewbl1, d6ewbl2
  • Heterogens: EDO

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ewbF (F:)
    gqivltqsptimsaspgekvtmtcsasssvdymhwyqqksgtspkrwiydtyklasgvpa
    rfsgsgsgtsysltinsmeaedaatyycqqwssnpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ewbF (F:)
    qivltqsptimsaspgekvtmtcsasssvdymhwyqqksgtspkrwiydtyklasgvpar
    fsgsgsgtsysltinsmeaedaatyycqqwssnpltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfn
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ewbI (I:)
    gqivltqsptimsaspgekvtmtcsasssvdymhwyqqksgtspkrwiydtyklasgvpa
    rfsgsgsgtsysltinsmeaedaatyycqqwssnpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ewbI (I:)
    gqivltqsptimsaspgekvtmtcsasssvdymhwyqqksgtspkrwiydtyklasgvpa
    rfsgsgsgtsysltinsmeaedaatyycqqwssnpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6ewbK (K:)
    gqivltqsptimsaspgekvtmtcsasssvdymhwyqqksgtspkrwiydtyklasgvpa
    rfsgsgsgtsysltinsmeaedaatyycqqwssnpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ewbK (K:)
    gqivltqsptimsaspgekvtmtcsasssvdymhwyqqksgtspkrwiydtyklasgvpa
    rfsgsgsgtsysltinsmeaedaatyycqqwssnpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgngvlnswtdqdskdstysmsstltltky
    erhnsytceathktstspivksfnr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ewbL (L:)
    gqivltqsptimsaspgekvtmtcsasssvdymhwyqqksgtspkrwiydtyklasgvpa
    rfsgsgsgtsysltinsmeaedaatyycqqwssnpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ewbL (L:)
    qivltqsptimsaspgekvtmtcsasssvdymhwyqqksgtspkrwiydtyklasgvpar
    fsgsgsgtsysltinsmeaedaatyycqqwssnpltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr