PDB entry 6ew3

View 6ew3 on RCSB PDB site
Description: Crystal structure of the metallo-beta-lactamase VIM-2 with ML302F
Class: hydrolase
Keywords: metal binding, HYDROLASE, ANTIBIOTIC RESISTANCE, xchem, complex
Deposited on 2017-11-03, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase VIM-2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ew3a_
  • Chain 'B':
    Compound: Metallo-beta-lactamase VIM-2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ew3b_
  • Heterogens: S3C, ZN, FMT, DMS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ew3A (A:)
    eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
    taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
    thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
    adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ew3B (B:)
    eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
    taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
    thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
    adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ew3B (B:)
    eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
    taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
    thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
    adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr