PDB entry 6ev2

View 6ev2 on RCSB PDB site
Description: Crystal structure of antibody against schizophyllan in complex with laminarihexaose
Class: immune system
Keywords: Antibody, Fab, Schizophyllan, laminarihexaose, immune system
Deposited on 2017-11-01, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EV2 (0-End)
  • Chain 'B':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EV2 (0-216)
    Domains in SCOPe 2.07: d6ev2b1, d6ev2b2
  • Chain 'C':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EV2 (0-221)
  • Chain 'D':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EV2 (0-216)
    Domains in SCOPe 2.07: d6ev2d1, d6ev2d2
  • Chain 'E':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EV2 (0-End)
  • Chain 'F':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EV2 (0-End)
    Domains in SCOPe 2.07: d6ev2f1, d6ev2f2
  • Chain 'G':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EV2 (0-End)
  • Chain 'H':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EV2 (0-End)
    Domains in SCOPe 2.07: d6ev2h1, d6ev2h2
  • Heterogens: BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ev2B (B:)
    divltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklelkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglrspvtksfnrgecaaah
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ev2D (D:)
    divltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklelkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglrspvtksfnrgecaaah
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ev2F (F:)
    divltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklelkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglrspvtksfnrgecaaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ev2F (F:)
    divltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklelkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglrspvtksfnrgec
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ev2H (H:)
    divltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklelkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglrspvtksfnrgecaaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ev2H (H:)
    divltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklelkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglrspvtksfnrgec