PDB entry 6eum

View 6eum on RCSB PDB site
Description: crystal structure of bcii metallo-beta-lactamase in complex with dz-307
Class: hydrolase
Keywords: antimicrobial resistance, metallo beta lactamase, inhibitor, hydrolase
Deposited on 2017-10-30, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Bacillus cereus [TaxId:1396]
    Gene: blm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6euma_
  • Heterogens: BY5, ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eumA (A:)
    sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
    dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
    eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn
    vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eumA (A:)
    ktviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltk
    eliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplg
    dlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvaday
    vnewstsienvlkryrninavvpghgevgdkglllhtldllk