PDB entry 6eue

View 6eue on RCSB PDB site
Description: Rivastigmine analogue bound to Tc ACHE.
Class: hydrolase
Keywords: Cholinesterase, alzheimer disease, organophosphate, carbamylated, HYDROLASE
Deposited on 2017-10-30, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Tetronarce californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6euea_
  • Heterogens: 1PE, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eueA (A:)
    hsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnast
    ypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfys
    gsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhd
    niqffggdpktvtifgexaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegr
    rravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffp
    tslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvph
    andlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyf
    fnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnp
    nephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eueA (A:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgexaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat