PDB entry 6eub

View 6eub on RCSB PDB site
Description: The fibrinogen-like domain of human Angptl4
Class: signaling protein
Keywords: Lipid metabolism, plasma triglyceride, angiopoietin-like, coronary artery disease, SIGNALING PROTEIN
Deposited on 2017-10-30, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiopoietin-related protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ANGPTL4, ARP4, HFARP, PGAR, PP1158, PSEC0166, UNQ171/PRO197
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6euba_
  • Heterogens: 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eubA (A:)
    mhhhhhhmlprdcqelfqvgerqsglfeiqpqgsppflvnckmtsdggwtviqrrhdgsv
    dfnrpweaykagfgdphgefwlglekvhsitgdrnsrlavqlrdwdgnaellqfsvhlgg
    edtayslqltapvagqlgattvppsglsvpfstwdqdhdlrrdkncakslsggwwfgtcs
    hsnlngqyfrsipqqrqklkkgifwktwrgryyplqattmliqpmaaeaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eubA (A:)
    lprdcqelfqvgerqsglfeiqpqgsppflvnckmtsdggwtviqrrhdgsvdfnrpwea
    ykagfgdphgefwlglekvhsitgdrnsrlavqlrdwdgnaellqfsvhlggedtayslq
    ltapvagqlgattvppsglsvpfstwdqdhdlrrdkncakslsggwwfgtcshsnlngqy
    frsipqrqklkkgifwktwrgryyplqattmliqpm