PDB entry 6eua

View 6eua on RCSB PDB site
Description: The fibrinogen-like domain of human Angptl3
Class: signaling protein
Keywords: lipid metabolism, plasma triglyceride, angiopoietin-like, coronary artery disease, SIGNALING PROTEIN
Deposited on 2017-10-30, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiopoietin-related protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ANGPTL3, ANGPT5, UNQ153/PRO179
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5C1 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d6euaa1, d6euaa2
  • Chain 'B':
    Compound: Angiopoietin-related protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ANGPTL3, ANGPT5, UNQ153/PRO179
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5C1 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d6euab1, d6euab2
  • Chain 'C':
    Compound: Angiopoietin-related protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ANGPTL3, ANGPT5, UNQ153/PRO179
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5C1 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d6euac1, d6euac2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6euaA (A:)
    mhhhhhhmipaecttiynrgehtsgmyairpsnsqvfhvycdvisgspwtliqhridgsq
    nfnetwenykygfgrldgefwlglekiysivkqsnyvlrieledwkdnkhyieysfylgn
    hetnytlhlvaitgnvpnaipenkdlvfstwdhkakghfncpegysggwwwhdecgennl
    ngkynkprakskperrrglswksqngrlysikstkmlihptdsesfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6euaA (A:)
    mipaecttiynrgehtsgmyairpsnsqvfhvycdvisgspwtliqhridgsqnfnetwe
    nykygfgrldgefwlglekiysivkqsnyvlrieledwkdnkhyieysfylgnhetnytl
    hlvaitgnvpnaipenkdlvfstwdhkafncpegysggwwwhdecgennlngkynkrgls
    wksqngrlysikstkmlihptd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6euaB (B:)
    mhhhhhhmipaecttiynrgehtsgmyairpsnsqvfhvycdvisgspwtliqhridgsq
    nfnetwenykygfgrldgefwlglekiysivkqsnyvlrieledwkdnkhyieysfylgn
    hetnytlhlvaitgnvpnaipenkdlvfstwdhkakghfncpegysggwwwhdecgennl
    ngkynkprakskperrrglswksqngrlysikstkmlihptdsesfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6euaB (B:)
    mipaecttiynrgehtsgmyairpsnsqvfhvycdvisgspwtliqhridgsqnfnetwe
    nykygfgrldgefwlglekiysivkqsnyvlrieledwkdnkhyieysfylgnhetnytl
    hlvaitgnvpnaipenkdlvfstwdhkahfncpegysggwwwhdecgennlngkynrgls
    wksqngrlysikstkmlihpt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6euaC (C:)
    mhhhhhhmipaecttiynrgehtsgmyairpsnsqvfhvycdvisgspwtliqhridgsq
    nfnetwenykygfgrldgefwlglekiysivkqsnyvlrieledwkdnkhyieysfylgn
    hetnytlhlvaitgnvpnaipenkdlvfstwdhkakghfncpegysggwwwhdecgennl
    ngkynkprakskperrrglswksqngrlysikstkmlihptdsesfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6euaC (C:)
    mipaecttiynrgehtsgmyairpsnsqvfhvycdvisgspwtliqhridgsqnfnetwe
    nykygfgrldgefwlglekiysivkqsnyvlrieledwkdnkhyieysfylgnhetnytl
    hlvaitgnvpnaipenkdlvfstwdhkancpegysggwwwhdecgennlngkynglswks
    qngrlysikstkmlihpt