PDB entry 6eu9

View 6eu9 on RCSB PDB site
Description: Crystal structure of Platynereis dumerilii RAR ligand-binding domain in complex with all-trans retinoic acid
Class: transcription
Keywords: Retinoic acid, ancestral receptor, sensor, TRANSCRIPTION
Deposited on 2017-10-29, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinoic acid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EU9
    Domains in SCOPe 2.07: d6eu9a_
  • Chain 'B':
    Compound: retinoic acid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EU9
    Domains in SCOPe 2.07: d6eu9b_
  • Chain 'C':
    Compound: retinoic acid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EU9
    Domains in SCOPe 2.07: d6eu9c_
  • Chain 'D':
    Compound: retinoic acid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EU9
    Domains in SCOPe 2.07: d6eu9d_
  • Heterogens: REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eu9A (A:)
    gseltedeeemvekilkaheetfpyltdddkyrltqeelekgnvilwervselstkaian
    vvdfgkqvpvftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqle
    vggfgtltptifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepilet
    lkhyvrkrrpdsphsfaklllkltdlrslsvkgaervlqlrmempgelpplilemldrte
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eu9A (A:)
    eltedeeemvekilkaheetfpyltdddkyrltqilwervselstkaianvvdfgkqvpv
    ftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqlevggfgtltpt
    ifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepiletlkhyvrkrrp
    dsphsfaklllkltdlrslsvkgaervlqlrmempgelpplilemld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eu9B (B:)
    gseltedeeemvekilkaheetfpyltdddkyrltqeelekgnvilwervselstkaian
    vvdfgkqvpvftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqle
    vggfgtltptifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepilet
    lkhyvrkrrpdsphsfaklllkltdlrslsvkgaervlqlrmempgelpplilemldrte
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eu9B (B:)
    eltedeeemvekilkaheetfpyltdddkyrltqilwervselstkaianvvdfgkqvpv
    ftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqlevggfgtltpt
    ifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepiletlkhyvrkrrp
    dsphsfaklllkltdlrslsvkgaervlqlrmempgelpplilemld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eu9C (C:)
    gseltedeeemvekilkaheetfpyltdddkyrltqeelekgnvilwervselstkaian
    vvdfgkqvpvftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqle
    vggfgtltptifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepilet
    lkhyvrkrrpdsphsfaklllkltdlrslsvkgaervlqlrmempgelpplilemldrte
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eu9C (C:)
    eltedeeemvekilkaheetfpyltdddkyrltqilwervselstkaianvvdfgkqvpv
    ftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqlevggfgtltpt
    ifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepiletlkhyvrkrrp
    dsphsfaklllkltdlrslsvkgaervlqpplileml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6eu9D (D:)
    gseltedeeemvekilkaheetfpyltdddkyrltqeelekgnvilwervselstkaian
    vvdfgkqvpvftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqle
    vggfgtltptifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepilet
    lkhyvrkrrpdsphsfaklllkltdlrslsvkgaervlqlrmempgelpplilemldrte
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eu9D (D:)
    eltedeeemvekilkaheetfpyltdddkyrltqilwervselstkaianvvdfgkqvpv
    ftqlstndqitllkaacleiiilrlasryddkedtmsfsngltltqqqlevggfgtltpt
    ifkfarslvelsvdtaeyamlsliclisgdrsglehpekveqkqepiletlkhyvrkrrp
    dsphsfaklllkltdlrslsvkgaervlqlrmempgelpplilemld