PDB entry 6eta

View 6eta on RCSB PDB site
Description: Crystal Structure of Human Gamma-D crystallin Mutant P23T+R36S at Room Temperature
Class: structural protein
Keywords: age-related cateract eye lens protein structural protein, STRUCTURAL PROTEIN
Deposited on 2017-10-25, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-crystallin D
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYGD, CRYG4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07320
      • engineered mutation (23)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d6etaa_
  • Chain 'B':
    Compound: Gamma-crystallin D
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYGD, CRYG4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07320
      • engineered mutation (23)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d6etab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6etaA (A:)
    mgkitlyedrgfqgrhyecssdhtnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrr
    gdyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfne
    ihslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6etaA (A:)
    gkitlyedrgfqgrhyecssdhtnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
    dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
    hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6etaB (B:)
    mgkitlyedrgfqgrhyecssdhtnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrr
    gdyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfne
    ihslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6etaB (B:)
    gkitlyedrgfqgrhyecssdhtnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
    dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
    hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvi