PDB entry 6esx

View 6esx on RCSB PDB site
Description: Caulobacter crescentus Trx1
Class: cell cycle
Keywords: Thioredoxin, CCNA_03653, Trx1, cell cycle, ClpXP, redox
Deposited on 2017-10-24, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1
    Species: Caulobacter crescentus NA1000 [TaxId:565050]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H3CDN9 (Start-109)
      • expression tag (110-111)
    Domains in SCOPe 2.07: d6esxa1, d6esxa2
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Caulobacter crescentus NA1000 [TaxId:565050]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H3CDN9 (Start-109)
      • expression tag (110)
    Domains in SCOPe 2.07: d6esxb1, d6esxb2
  • Chain 'C':
    Compound: Thioredoxin 1
    Species: Caulobacter crescentus NA1000 [TaxId:565050]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H3CDN9 (Start-109)
      • expression tag (110-111)
    Domains in SCOPe 2.07: d6esxc1, d6esxc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6esxA (A:)
    mstvavtdatfeadvlksskpvlvdfwaewcgpckqiapaleqlseeladvvtiakvnie
    dspttpsrygvrgiptmmlfrdgqmtsmkvgampkqkilewlneagvqaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6esxA (A:)
    stvavtdatfeadvlksskpvlvdfwaewcgpckqiapaleqlseeladvvtiakvnied
    spttpsrygvrgiptmmlfrdgqmtsmkvgampkqkilewlneagvqaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6esxB (B:)
    mstvavtdatfeadvlksskpvlvdfwaewcgpckqiapaleqlseeladvvtiakvnie
    dspttpsrygvrgiptmmlfrdgqmtsmkvgampkqkilewlneagvqaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6esxB (B:)
    stvavtdatfeadvlksskpvlvdfwaewcgpckqiapaleqlseeladvvtiakvnied
    spttpsrygvrgiptmmlfrdgqmtsmkvgampkqkilewlneagvqaal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6esxC (C:)
    mstvavtdatfeadvlksskpvlvdfwaewcgpckqiapaleqlseeladvvtiakvnie
    dspttpsrygvrgiptmmlfrdgqmtsmkvgampkqkilewlneagvqaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6esxC (C:)
    stvavtdatfeadvlksskpvlvdfwaewcgpckqiapaleqlseeladvvtiakvnied
    spttpsrygvrgiptmmlfrdgqmtsmkvgampkqkilewlneagvqaale