PDB entry 6esn

View 6esn on RCSB PDB site
Description: Ligand complex of RORg LBD
Class: transcription
Keywords: RAR-related Orphan Receptor-g (RORg), TRANSCRIPTION, RORG LIGAND, STRUCTURE-BASED DESIGN
Deposited on 2017-10-23, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (22-264)
      • expression tag (15-21)
      • expression tag (265-266)
    Domains in SCOPe 2.07: d6esna1, d6esna2, d6esna3
  • Chain 'C':
    Compound: lys-his-lys-ile-leu-his-arg-leu-leu-gln-asp-ser
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ESN (0-11)
  • Heterogens: BWE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6esnA (A:)
    mhnhnhnhnhnhnggenlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsr
    eevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvl
    vrmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialyta
    lvlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhver
    lqifqhlhpivvqaafpplykelfsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6esnA (A:)
    enlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemw
    ercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvf
    fegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekr
    kveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaa
    fpplykelfsgg
    

  • Chain 'C':
    No sequence available.