PDB entry 6erk

View 6erk on RCSB PDB site
Description: Crystal structure of diaminopelargonic acid aminotransferase from Psychrobacter cryohalolentis
Class: transferase
Keywords: diaminopelargonic acid, aminotransferase, PLP, transaminase, psychrophilic, dimer, TRANSFERASE
Deposited on 2017-10-18, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Psychrobacter cryohalolentis K5 [TaxId:335284]
    Gene: Pcryo_0361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6erka_
  • Chain 'B':
    Compound: aminotransferase
    Species: Psychrobacter cryohalolentis K5 [TaxId:335284]
    Gene: Pcryo_0361
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QDV8 (20-End)
      • expression tag (18-19)
    Domains in SCOPe 2.07: d6erkb1, d6erkb2
  • Heterogens: SO4, EDO, GOL, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6erkA (A:)
    mgsdkihhhhhhenlyfqghmttvstndfdqqhlwhpyaslpptypnividraegiyivt
    edgtrlidgmsswwasvhgynhpklnaamieqlgkmahvmfgglthqpaidlgkkllsiv
    pagldaifyadsgsiavevalkmalqyqiaakrpskcqfasthsgyygdtwhamsvcdpi
    ngmhslygkqlpmqhfvaappmgferdltqserealteffvknsdklagfiiepiiqgag
    gmrfyspqylqllrklcdeydvlliadeiatgfgrsgklfacehaaispdimtigkaltg
    gymtfaatlstreiadtisqsdypalmhgptfmgnplacavacasidlivsydiearten
    mqaimneqlapavslegvkevrclgavavielneavdmpifqtllinngiwvrpfgklvy
    imppyvitddelttlcqallkvvssyltrkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erkA (A:)
    mttvstndfdqqhlwhpyaslpptypnividraegiyivtedgtrlidgmsswwasvhgy
    nhpklnaamieqlgkmahvmfgglthqpaidlgkkllsivpagldaifyadsgsiaveva
    lkmalqyqiaakrpskcqfasthsgyygdtwhamsvcdkqlpmqhfvaappmgferdltq
    serealteffvknsdklagfiiepiiqgaggmrfyspqylqllrklcdeydvlliadeia
    tgfgrsgklfacehaaispdimtigkaltggymtfaatlstreiadtisqsdypalmhgp
    tfmgnplacavacasidlivsydieartenmqaimneqlapavslegvkevrclgavavi
    elneavdmpifqtllinngiwvrpfgklvyimppyvitddelttlcqallkvvssyltrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6erkB (B:)
    mgsdkihhhhhhenlyfqghmttvstndfdqqhlwhpyaslpptypnividraegiyivt
    edgtrlidgmsswwasvhgynhpklnaamieqlgkmahvmfgglthqpaidlgkkllsiv
    pagldaifyadsgsiavevalkmalqyqiaakrpskcqfasthsgyygdtwhamsvcdpi
    ngmhslygkqlpmqhfvaappmgferdltqserealteffvknsdklagfiiepiiqgag
    gmrfyspqylqllrklcdeydvlliadeiatgfgrsgklfacehaaispdimtigkaltg
    gymtfaatlstreiadtisqsdypalmhgptfmgnplacavacasidlivsydiearten
    mqaimneqlapavslegvkevrclgavavielneavdmpifqtllinngiwvrpfgklvy
    imppyvitddelttlcqallkvvssyltrkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erkB (B:)
    ghmttvstndfdqqhlwhpyaslpptypnividraegiyivtedgtrlidgmsswwasvh
    gynhpklnaamieqlgkmahvmfgglthqpaidlgkkllsivpagldaifyadsgsiave
    valkmalqyqiaakrpskcqfasthsgyygdtwhamsvcdpmqhfvaappmgferdltqs
    erealteffvknsdklagfiiepiiqgaggmrfyspqylqllrklcdeydvlliadeiat
    gfgrsgklfacehaaispdimtigkaltggymtfaatlstreiadtisqsdypalmhgpt
    fmgnplacavacasidlivsydieartenmqaimneqlapavslegvkevrclgavavie
    lneavdmpifqtllinngiwvrpfgklvyimppyvitddelttlcqallkvvssyltr