PDB entry 6erd

View 6erd on RCSB PDB site
Description: Crystal structure of a putative acetyltransferase from Bacillus cereus species.
Class: transferase
Keywords: Acetyltransferase Bacillus cereus Unidentified acetyl acceptor, TRANSFERASE
Deposited on 2017-10-18, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside N6'-acetyltransferase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_2494
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81D84 (43-210)
      • expression tag (40-42)
    Domains in SCOPe 2.07: d6erda1, d6erda2
  • Chain 'B':
    Compound: Aminoglycoside N6'-acetyltransferase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_2494
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81D84 (43-210)
      • expression tag (42)
    Domains in SCOPe 2.07: d6erdb1, d6erdb2
  • Chain 'C':
    Compound: Aminoglycoside N6'-acetyltransferase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_2494
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81D84 (43-End)
      • expression tag (41-42)
    Domains in SCOPe 2.07: d6erdc1, d6erdc2
  • Chain 'D':
    Compound: Aminoglycoside N6'-acetyltransferase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_2494
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81D84 (43-210)
      • expression tag (41-42)
    Domains in SCOPe 2.07: d6erdd1, d6erdd2
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6erdA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrdpnsssvdklviklesfkksdfkqlinw
    inseefliqwsgnaftfpldeqqlekyiesantlafkvvdeetsdvighislgqidnink
    sarigkvlvgntkmrgrsigkhmmkavlhiafdelklhrvtlgvydfntsaiscyekigf
    vkegllreskrvgetywnlwemsmleyewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erdA (A:)
    klviklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvd
    eetsdvighislgqidninksarigkvlvgntrsigkhmmkavlhiafdelklhrvtlgv
    ydfntsaiscyekigfvkegllreskrvgetywnlwemsmleyewkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6erdB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrdpnsssvdklviklesfkksdfkqlinw
    inseefliqwsgnaftfpldeqqlekyiesantlafkvvdeetsdvighislgqidnink
    sarigkvlvgntkmrgrsigkhmmkavlhiafdelklhrvtlgvydfntsaiscyekigf
    vkegllreskrvgetywnlwemsmleyewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erdB (B:)
    viklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvdee
    tsdvighislgqidninksarigkvlvsigkhmmkavlhiafdelklhrvtlgvydfnts
    aiscyekigfvkegllreskrvgetywnlwemsmleyewkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6erdC (C:)
    mgsshhhhhhssglvprgshmasmtggqqmgrdpnsssvdklviklesfkksdfkqlinw
    inseefliqwsgnaftfpldeqqlekyiesantlafkvvdeetsdvighislgqidnink
    sarigkvlvgntkmrgrsigkhmmkavlhiafdelklhrvtlgvydfntsaiscyekigf
    vkegllreskrvgetywnlwemsmleyewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erdC (C:)
    lviklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvde
    etsdvighislgqidninksarigkvlvgnrsigkhmmkavlhiafdelklhrvtlgvyd
    fntsaiscyekigfvkegllreskrvgetywnlwemsmleyewk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6erdD (D:)
    mgsshhhhhhssglvprgshmasmtggqqmgrdpnsssvdklviklesfkksdfkqlinw
    inseefliqwsgnaftfpldeqqlekyiesantlafkvvdeetsdvighislgqidnink
    sarigkvlvgntkmrgrsigkhmmkavlhiafdelklhrvtlgvydfntsaiscyekigf
    vkegllreskrvgetywnlwemsmleyewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erdD (D:)
    lviklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvde
    etsdvighislgqidninksarigkvlvgntkmrgrsigkhmmkavlhiafdelklhrvt
    lgvydfntsaiscyekigfvkegllreskrvgetywnlwemsmleyewkk