PDB entry 6er7

View 6er7 on RCSB PDB site
Description: CHEMOTAXIS PROTEIN CHEY FROM Pyrococcus horikoshiI
Class: signaling protein
Keywords: signal transduction protein, signaling protein
Deposited on 2017-10-17, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 120aa long hypothetical chemotaxis protein (CheY)
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6er7a_
  • Chain 'B':
    Compound: 120aa long hypothetical chemotaxis protein (CheY)
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6er7b_
  • Chain 'C':
    Compound: 120aa long hypothetical chemotaxis protein (CheY)
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6er7c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6er7A (A:)
    marvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemd
    gitavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6er7A (A:)
    arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
    itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6er7B (B:)
    marvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemd
    gitavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6er7B (B:)
    arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
    itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6er7C (C:)
    marvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemd
    gitavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6er7C (C:)
    arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
    itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl