PDB entry 6epk

View 6epk on RCSB PDB site
Description: crystal structure of the precursor membrane protein-envelope protein heterodimer from the yellow fever virus
Class: viral protein
Keywords: prm-e protein complex, viral protein, heterodimer, maturation
Deposited on 2017-10-11, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Yellow fever virus [TaxId:11089]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DV88 (0-391)
      • expression tag (392-406)
    Domains in SCOPe 2.07: d6epka1, d6epka2, d6epka3
  • Chain 'B':
    Compound: Precursor Membrane Protein
    Species: Yellow fever virus [TaxId:11089]
    Gene: prM
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Envelope protein E
    Species: Yellow fever virus [TaxId:11089]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DV88 (0-391)
      • expression tag (392-406)
    Domains in SCOPe 2.07: d6epkd1, d6epkd2, d6epkd3
  • Chain 'E':
    Compound: Precursor Membrane Protein
    Species: Yellow fever virus [TaxId:11089]
    Gene: prM
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, NAG, FUC, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6epkA (A:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidgpaearkvc
    ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
    ecqvqtavdfgnsyiaemekeswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgtsykmc
    tdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaainkgilvtvnpiastnd
    devlievnppfgdsyiivgtgdsrltyqwhkeddddkagwshpqfekgggsgggsgggsw
    shpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6epkA (A:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidgpaearkvc
    ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
    ecqvqtavdfgnsyiaemekeswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgtsykmc
    tdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaainkgilvtvnpiastnd
    devlievnppfgdsyiivgtgdsrltyqwhkeddddkagwshpqfek
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6epkD (D:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidgpaearkvc
    ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
    ecqvqtavdfgnsyiaemekeswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgtsykmc
    tdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaainkgilvtvnpiastnd
    devlievnppfgdsyiivgtgdsrltyqwhkeddddkagwshpqfekgggsgggsgggsw
    shpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6epkD (D:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidgpaearkvc
    ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
    ecqvqtavdfgnsyiaemekeswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgtsykmc
    tdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaainkgilvtvnpiastnd
    devlievnppfgdsyiivgtgdsrltyqwhkeddddkagwshpqfek
    

  • Chain 'E':
    No sequence available.