PDB entry 6eox

View 6eox on RCSB PDB site
Description: Crystal structure of MMP12 in complex with carboxylic inhibitor LP165.
Class: hydrolase
Keywords: metzincin, carboxylate inhibitor alternative zinc-binding groups, HYDROLASE
Deposited on 2017-10-10, released 2018-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered mutation (66)
    Domains in SCOPe 2.08: d6eoxa_
  • Heterogens: ZN, CA, BKW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6eoxA (A:)
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg

    Sequence, based on observed residues (ATOM records): (download) 
    >6eoxA (A:)
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg