PDB entry 6enp

View 6enp on RCSB PDB site
Description: Atomic resolution structure of human RNase 6 in the presence of phosphate anions in P21 space group.
Class: hydrolase
Keywords: RNAse k6, hydrolase, pancreatic ribonuclease
Deposited on 2017-10-05, released 2018-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease K6
  Species: Homo sapiens [TaxId:9606]
  Gene: RNASE6, RNS6
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q93091 (1-127)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6enpa1, d6enpa2
• Heterogens: PO4, ZN, NA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6enpA (A:)
  mwpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdlls
  ivcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklv
  pvhldsil