PDB entry 6elr

View 6elr on RCSB PDB site
Description: Human jak1 kinase domain in complex with compound 7
Class: transferase
Keywords: Janus Kinase 1 kinase domain (JAK1), TRANSFERASE
Deposited on 2017-09-29, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6elra_
  • Chain 'B':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6elrb_
  • Heterogens: BFK, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6elrA (A:)
    divsekkpatevdpthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkpe
    sggnhiadlkkeieilrnlyhenivkykgictedggngiklimeflpsgslkeylpknkn
    kinlkqqlkyavqickgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdke
    yytvkddrdspvfwyapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmig
    pthgqmtvtrlvntlkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeall
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elrA (A:)
    divsekkpatevdpthfekrflkrirdlgegkvelcrydpegdntgeqvavkslkhiadl
    kkeieilrnlyhenivkykgictengiklimeflpsgslkeylpknknkinlkqqlkyav
    qickgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspv
    fwyapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlv
    ntlkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeallk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6elrB (B:)
    divsekkpatevdpthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkpe
    sggnhiadlkkeieilrnlyhenivkykgictedggngiklimeflpsgslkeylpknkn
    kinlkqqlkyavqickgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdke
    yytvkddrdspvfwyapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmig
    pthgqmtvtrlvntlkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeall
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elrB (B:)
    vdpthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkphiadlkkeieil
    rnlyhenivkykgictengiklimeflpsgslkeylpknknkinlkqqlkyavqickgmd
    ylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspvfwyapec
    lmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlvntlkegk
    rlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeallk