PDB entry 6elq

View 6elq on RCSB PDB site
Description: Carbon Monoxide Dehydrogenase IV from Carboxydothermus hydrogenoformans
Class: oxidoreductase
Keywords: Anaerobiosis, Carbon Dioxide, Carbon Monoxide, Crystallization, Iron, Ligands, Nickel, Recombinant Proteins, OXIDOREDUCTASE
Deposited on 2017-09-29, released 2018-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-03, with a file datestamp of 2017-12-29.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbon monoxide dehydrogenase
    Species: Carboxydothermus hydrogenoformans [TaxId:129958]
    Gene: cooSIV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6elqa_
  • Chain 'B':
    Compound: carbon monoxide dehydrogenase
    Species: Carboxydothermus hydrogenoformans [TaxId:129958]
    Gene: cooSIV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6elqb_
  • Chain 'X':
    Compound: carbon monoxide dehydrogenase
    Species: Carboxydothermus hydrogenoformans [TaxId:129958]
    Gene: cooSIV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6elqx_
  • Heterogens: SF4, BF8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6elqA (A:)
    mdksklsvdpvipnlyrkareegistvfdryeaqqpqcgfgltglccrhcvqgpcridpf
    gegpqagicgataevitarnllrqvtagaaahvdhaydvlevleqiaqgtesysikdqek
    lkqvaftlgidtankteqeiveemcqiiyrdfansgatpmtylkansprerletweklgv
    lprnpdreirealhqttmgmdadpvnlilktirlglvdgfaglklatdlqdiifgtpqpv
    vteanlgvlkedyvniivhghvpllsekivewsrkledeakkagakginlagicctgnev
    lmrqgvplatnflaqelaiitgavdlmvvdvqcimpslaeiaacyhtrlvttmpivkipg
    aehvpfttetadeasqqivrmaiesyqkrnpakvyiprekakvvagfsveaivkalakln
    pddplkplidnivsgnilgvvatvgcnnvkvkhdwfhielvkeliknnvlvvttgcsaha
    lakaglmdpaaaewageglravltaigtandlggplppvlhmgscvdnsrigdlviavan
    ylkvspkdlpiaasapeyqhekalsigtwavamgimthlgvvppvvgsskvtriltqdae
    aliggkfyvetdpykaaagiiehikakrallnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elqA (A:)
    sklsvdpvipnlyrkareegistvfdryeaqqpqcgfgltglccrhcvqgpcridpfgeg
    pqagicgataevitarnllrqvtagaaahvdhaydvlevleqiaqgtesysikdqeklkq
    vaftlgidtankteqeiveemcqiiyrdfansgatpmtylkansprerletweklgvlpr
    npdreirealhqttmgmdadpvnlilktirlglvdgfaglklatdlqdiifgtpqpvvte
    anlgvlkedyvniivhghvpllsekivewsrkledeakkagakginlagicctgnevlmr
    qgvplatnflaqelaiitgavdlmvvdvqcimpslaeiaacyhtrlvttmpivkipgaeh
    vpfttetadeasqqivrmaiesyqkrnpakvyiprekakvvagfsveaivkalaklnpdd
    plkplidnivsgnilgvvatvgcnnvkvkhdwfhielvkeliknnvlvvttgcsahalak
    aglmdpaaaewageglravltaigtandlggplppvlhmgscvdnsrigdlviavanylk
    vspkdlpiaasapeyqhekalsigtwavamgimthlgvvppvvgsskvtriltqdaeali
    ggkfyvetdpykaaagiiehikakrallnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6elqB (B:)
    mdksklsvdpvipnlyrkareegistvfdryeaqqpqcgfgltglccrhcvqgpcridpf
    gegpqagicgataevitarnllrqvtagaaahvdhaydvlevleqiaqgtesysikdqek
    lkqvaftlgidtankteqeiveemcqiiyrdfansgatpmtylkansprerletweklgv
    lprnpdreirealhqttmgmdadpvnlilktirlglvdgfaglklatdlqdiifgtpqpv
    vteanlgvlkedyvniivhghvpllsekivewsrkledeakkagakginlagicctgnev
    lmrqgvplatnflaqelaiitgavdlmvvdvqcimpslaeiaacyhtrlvttmpivkipg
    aehvpfttetadeasqqivrmaiesyqkrnpakvyiprekakvvagfsveaivkalakln
    pddplkplidnivsgnilgvvatvgcnnvkvkhdwfhielvkeliknnvlvvttgcsaha
    lakaglmdpaaaewageglravltaigtandlggplppvlhmgscvdnsrigdlviavan
    ylkvspkdlpiaasapeyqhekalsigtwavamgimthlgvvppvvgsskvtriltqdae
    aliggkfyvetdpykaaagiiehikakrallnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elqB (B:)
    sklsvdpvipnlyrkareegistvfdryeaqqpqcgfgltglccrhcvqgpcridpfgeg
    pqagicgataevitarnllrqvtagaaahvdhaydvlevleqiaqgtesysikdqeklkq
    vaftlgidtankteqeiveemcqiiyrdfansgatpmtylkansprerletweklgvlpr
    npdreirealhqttmgmdadpvnlilktirlglvdgfaglklatdlqdiifgtpqpvvte
    anlgvlkedyvniivhghvpllsekivewsrkledeakkagakginlagicctgnevlmr
    qgvplatnflaqelaiitgavdlmvvdvqcimpslaeiaacyhtrlvttmpivkipgaeh
    vpfttetadeasqqivrmaiesyqkrnpakvyiprekakvvagfsveaivkalaklnpdd
    plkplidnivsgnilgvvatvgcnnvkvkhdwfhielvkeliknnvlvvttgcsahalak
    aglmdpaaaewageglravltaigtandlggplppvlhmgscvdnsrigdlviavanylk
    vspkdlpiaasapeyqhekalsigtwavamgimthlgvvppvvgsskvtriltqdaeali
    ggkfyvetdpykaaagiiehikakrallnl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6elqX (X:)
    mdksklsvdpvipnlyrkareegistvfdryeaqqpqcgfgltglccrhcvqgpcridpf
    gegpqagicgataevitarnllrqvtagaaahvdhaydvlevleqiaqgtesysikdqek
    lkqvaftlgidtankteqeiveemcqiiyrdfansgatpmtylkansprerletweklgv
    lprnpdreirealhqttmgmdadpvnlilktirlglvdgfaglklatdlqdiifgtpqpv
    vteanlgvlkedyvniivhghvpllsekivewsrkledeakkagakginlagicctgnev
    lmrqgvplatnflaqelaiitgavdlmvvdvqcimpslaeiaacyhtrlvttmpivkipg
    aehvpfttetadeasqqivrmaiesyqkrnpakvyiprekakvvagfsveaivkalakln
    pddplkplidnivsgnilgvvatvgcnnvkvkhdwfhielvkeliknnvlvvttgcsaha
    lakaglmdpaaaewageglravltaigtandlggplppvlhmgscvdnsrigdlviavan
    ylkvspkdlpiaasapeyqhekalsigtwavamgimthlgvvppvvgsskvtriltqdae
    aliggkfyvetdpykaaagiiehikakrallnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elqX (X:)
    sklsvdpvipnlyrkareegistvfdryeaqqpqcgfgltglccrhcvqgpcridpfgeg
    pqagicgataevitarnllrqvtagaaahvdhaydvlevleqiaqgtesysikdqeklkq
    vaftlgidtankteqeiveemcqiiyrdfansgatpmtylkansprerletweklgvlpr
    npdreirealhqttmgmdadpvnlilktirlglvdgfaglklatdlqdiifgtpqpvvte
    anlgvlkedyvniivhghvpllsekivewsrkledeakkagakginlagicctgnevlmr
    qgvplatnflaqelaiitgavdlmvvdvqcimpslaeiaacyhtrlvttmpivkipgaeh
    vpfttetadeasqqivrmaiesyqkrnpakvyiprekakvvagfsveaivkalaklnpdd
    plkplidnivsgnilgvvatvgcnnvkvkhdwfhielvkeliknnvlvvttgcsahalak
    aglmdpaaaewageglravltaigtandlggplppvlhmgscvdnsrigdlviavanylk
    vspkdlpiaasapeyqhekalsigtwavamgimthlgvvppvvgsskvtriltqdaeali
    ggkfyvetdpykaaagiiehikakrallnl