PDB entry 6elk

View 6elk on RCSB PDB site
Description: C.elegans MnSOD-3 mutant - Q142H
Class: oxidoreductase
Keywords: superoxide dismutase, manganese, OXIDOREDUCTASE
Deposited on 2017-09-29, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn] 2, mitochondrial
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sod-3, C08A9.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41977 (1-194)
      • engineered mutation (142)
    Domains in SCOPe 2.07: d6elka1, d6elka2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn] 2, mitochondrial
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sod-3, C08A9.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41977 (1-194)
      • engineered mutation (142)
    Domains in SCOPe 2.07: d6elkc1, d6elkc2
  • Heterogens: MN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6elkA (A:)
    mkhtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaia
    lqpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqg
    sgwgwlgyckkdkilkiatcanhdplegmvplfgidvwehayylqyknvrpdyvhaiwki
    anwkniserfanarq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elkA (A:)
    khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
    qpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqgs
    gwgwlgyckkdkilkiatcanhdplegmvplfgidvwehayylqyknvrpdyvhaiwkia
    nwkniserfanarq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6elkC (C:)
    mkhtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaia
    lqpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqg
    sgwgwlgyckkdkilkiatcanhdplegmvplfgidvwehayylqyknvrpdyvhaiwki
    anwkniserfanarq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elkC (C:)
    khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
    qpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqgs
    gwgwlgyckkdkilkiatcanhdplegmvplfgidvwehayylqyknvrpdyvhaiwkia
    nwkniserfanarq