PDB entry 6eks

View 6eks on RCSB PDB site
Description: Vibrio cholerae neuraminidase complexed with oseltamivir carboxylate
Class: hydrolase
Keywords: sialidase, bacterial protein, infection, HYDROLASE
Deposited on 2017-09-27, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Vibrio cholerae serotype O1 [TaxId:243277]
    Gene: nanH, VC_1784
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eksa1, d6eksa2, d6eksa3
  • Heterogens: G39, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eksA (A:)
    alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
    qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
    atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
    ayrdikfeiqgdvifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrt
    srdggitwdtelnlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikp
    wmpngifysvydvasgnwqapidvtdqvkersfqiagwggselyrrntslnsqqdwqsna
    kirivdgaanqiqvadgsrkyvvtlsidesgglvanlngvsapiilqsehakvhsfhdye
    lqysalnhtttlfvdgqqittwagevsqenniqfgnadaqidgrlhvqkivltqqghnlv
    efdafylaqqtpevekdleklgwtkiktgntmslygnasvnpgpghgitltrqqnisgsq
    ngrliypaivldrfflnvmsiysddggsnwqtgstlpipfrwksssiletlepseadmve
    lqngdllltarldfnqivngvnysprqqflskdggitwslleannanvfsnistgtvdas
    itrfeqsdgshfllftnpqgnpagtngrqnlglwfsfdegvtwkgpiqlvngasaysdiy
    qldsenaivivetdnsnmrilrmpitllkqkltlsqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eksA (A:)
    alfdynatgdtfdspakqgwmqdntnngsgvltnampawlvqgiggraqwtyslstnqha
    qassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvlatg
    taateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgvaayr
    dikfeiqgdvifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrtsrd
    ggitwdtelnlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikpwmp
    ngifysvydvasgnwqapidvtdqvkersfqiagwggselyrrntslnsqqdwqsnakir
    ivdgaanqiqvadgsrkyvvtlsidesgglvanlngvsapiilqsehakvhsfhdyelqy
    salnhtttlfvdgqqittwagevsqenniqfgnadaqidgrlhvqkivltqqghnlvefd
    afylaqqtpevekdleklgwtkiktgntmslygnasvnpgpghgitltrqqnisgsqngr
    liypaivldrfflnvmsiysddggsnwqtgstlpipfrwksssiletlepseadmvelqn
    gdllltarldfnqivngvnysprqqflskdggitwslleannanvfsnistgtvdasitr
    feqsdgshfllftnpqgnpagtngrqnlglwfsfdegvtwkgpiqlvngasaysdiyqld
    senaivivetdnsnmrilrmpitllkqkl