PDB entry 6ekh

View 6ekh on RCSB PDB site
Description: Crystal structure of activated CheY from Methanoccocus maripaludis
Class: metal binding protein
Keywords: Chemotaxis, archaea, phosphorylation, METAL BINDING PROTEIN
Deposited on 2017-09-26, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'Y':
    Compound: Chemotaxis protein cheY
    Species: Methanococcus maripaludis [TaxId:39152]
    Gene: cheY, MMP0933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ekhy_
  • Heterogens: BEF, MG, HOH

PDB Chain Sequences:

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >6ekhY (Y:)
    masivktmivddsafmrnilkrilsttnkyvvigeaangadaikmaeelqpdlismdivm
    petdgitatkaikektpeikivmctsvdqeqkmidavnagadgyivkpfqapkileqfnk
    lfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ekhY (Y:)
    sivktmivddsafmrnilkrilsttnkyvvigeaangadaikmaeelqpdlismdivmpe
    tdgitatkaikektpeikivmctsvdqeqkmidavnagadgyivkpfqapkileqfnklf
    p