PDB entry 6eh9

View 6eh9 on RCSB PDB site
Description: HA1.7 Human T-Cell Receptor specific for Influenza virus epitope PKYVKQNTLKLAT presented by Human Leukocyte Antigen HLA-DR0101
Class: immune system
Keywords: Human T Cell Receptor, Human Leukocute Antigen, Influenza Haemagglutinin epitope, 3D structure, IMMUNE SYSTEM
Deposited on 2017-09-12, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human T Cell Receptor Alpha Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6EH9 (0-201)
  • Chain 'B':
    Compound: Human T Cell Receptor Beta Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6EH9 (0-240)
    Domains in SCOPe 2.07: d6eh9b1, d6eh9b2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eh9B (B:)
    vkvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdip
    egysvsrekkerfslilesastnqtsmylcassstglpygytfgsgtrltvvedlnkvfp
    pevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    a