PDB entry 6eh0

View 6eh0 on RCSB PDB site
Description: Apo crystal structure of the Protein-Kinase A catalytic subunit from Criteculus
Class: transferase
Keywords: transferase, apo-structure
Deposited on 2017-09-12, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Cricetulus griseus [TaxId:10029]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eh0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eh0A (A:)
    ghmgnaaaakkgseqesvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrv
    mlvkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnly
    mvmeyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqq
    gyiqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagypp
    ffadqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwf
    attdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eh0A (A:)
    qesvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrvmlvkhketgnhyam
    kildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfsh
    lrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrv
    kgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekiv
    sgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkve
    apfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef