PDB entry 6egr

View 6egr on RCSB PDB site
Description: Crystal structure of Citrobacter freundii methionine gamma-lyase with V358Y replacement
Class: lyase
Keywords: methionine gamma-lyase, lyase
Deposited on 2017-09-12, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: AN672_11005, BED45_02240, BEH73_12300, CfB38_0199, HMPREF3212_02785, TO64_18625
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6egra_
  • Heterogens: PLP, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6egrA (A:)
    msdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytr
    lgnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafl
    shsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqga
    llvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkd
    itggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqye
    lgqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspyap
    eerlkagitdglirlsvgledpediindlehairkatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6egrA (A:)
    sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
    gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
    hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
    lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
    tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
    gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspyape
    erlkagitdglirlsvgledpediindlehairkat