PDB entry 6efh

View 6efh on RCSB PDB site
Description: Pyruvate decarboxylase from Kluyveromyces lactis soaked with pyruvamide
Class: lyase
Keywords: pyruvate decarboxylase, thiamine diphosphate, substrate activation, pyruvamide, LYASE
Deposited on 2018-08-16, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6efha1, d6efha2, d6efha3
  • Chain 'B':
    Compound: pyruvate decarboxylase
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6efhb1, d6efhb2, d6efhb3
  • Heterogens: PY0, TPP, MG, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6efhA (A:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6efhA (A:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgngd
    ftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasll
    dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp
    afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysy
    ktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneavad
    stplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttga
    tlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierlih
    getaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievmlp
    tmdapsnlvkqaqltaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6efhB (B:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6efhB (B:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvsslhhtlgngdftvfhr
    mssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpaslldtpidl
    slkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfpafvtpm
    gkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysyktkniv
    efhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneavadstplkq
    ewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttgatlgaaf
    aaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierlihgetaqy
    nciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievmlptmdaps
    nlvkqaqltaatnakn