PDB entry 6efg

View 6efg on RCSB PDB site
Description: Pyruvate decarboxylase from Kluyveromyces lactis
Class: lyase
Keywords: pyruvate decarboxylase, thiamine diphosphate, substrate activation, LYASE
Deposited on 2018-08-16, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6efga1, d6efga2, d6efga3
  • Chain 'B':
    Compound: pyruvate decarboxylase
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6efgb1, d6efgb2, d6efgb3
  • Chain 'D':
    Compound: pyruvate decarboxylase
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6efgd1, d6efgd2, d6efgd3
  • Chain 'E':
    Compound: pyruvate decarboxylase
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6efge1, d6efge2, d6efge3
  • Heterogens: TPP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6efgA (A:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6efgA (A:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvlhhtlgngdftvfhrms
    snisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpaslldtpidlsl
    kpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfpafvtpmgk
    gsidekhprfggvyvgtlsspavkeavesadlvlsvgallktknivefhsdytkirsatf
    pgvqmkfalqklltkvadaakgykpvpvpsepehneavadstplkqewvwtqvgeflreg
    dvvitetgtsafginqthfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvilf
    igdgslqltvqeistmirwglkpylfvlnndgytierlihgetaqynciqnwqhlellpt
    fgakdyeavrvsttgewnklttdekfqdntrirlievmlptmdapsnlvkqaqlta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6efgB (B:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6efgB (B:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvngdftvfhrmssniset
    tamitdintapaeidrcirttyvsqrpvylglpanlvdltvpaslldtpidlslkpndpe
    aeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfpafvtpmgkgsidek
    hprfggvyvgtlsspavkeavesadlvlsvgalnivefhsdytkirsatfpgvqmkfalq
    klltkvadaakgykpvpvpsepehneavadstplkqewvwtqvgeflregdvvitetgts
    afginqthfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvilfigdgslqltv
    qeistmirwglkpylfvlnndgytierlihgetaqynciqnwqhlellptfgakdyeavr
    vsttgewnklttdekfqdntrirlievmlptmdapsnlvkqaqltaatnakn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6efgD (D:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6efgD (D:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvhtlgngdftvfhrmssn
    isettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpaslldtpidlslkp
    ndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfpafvtpmgkgs
    idekhprfggvyvgtlsspavkeavesadlvlsvgalsyktknivefhsdytkirsatfp
    gvqmkfalqklltkvadaakgykpvpvpsepehneavadstplkqewvwtqvgeflregd
    vvitetgtsafginqthfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvilfi
    gdgslqltvqeistmirwglkpylfvlnndgytierlihgetaqynciqnwqhlellptf
    gakdyeavrvsttgewnklttdekfqdntrirlievmlptmdapsnlvkqaqltaat
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6efgE (E:)
    mseitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadg
    yarlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgng
    dftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasl
    ldtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqf
    pafvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsys
    yktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
    dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
    hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
    ptmdapsnlvkqaqltaatnakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6efgE (E:)
    seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
    arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvlhhtlgngdftvfhrms
    snisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpaslldtpidlsl
    kpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfpafvtpmgk
    gsidekhprfggvyvgtlsspavkeavesadlvlsvgallyktknivefhsdytkirsat
    fpgvqmkfalqklltkvadaakgykpvpvpsepehneavadstplkqewvwtqvgeflre
    gdvvitetgtsafginqthfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvil
    figdgslqltvqeistmirwglkpylfvlnndgytierlihgetaqynciqnwqhlellp
    tfgakdyeavrvsttgewnklttdekfqdntrirlievmlptmdapsnlvkqaqltaa