PDB entry 6eew

View 6eew on RCSB PDB site
Description: Crystal structure of Catharanthus roseus tryptophan decarboxylase in complex with L-tryptophan
Class: lyase
Keywords: Aromatic Amino Acid Decarboxylase, LYASE
Deposited on 2018-08-15, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aromatic-L-amino-acid decarboxylase
    Species: Catharanthus roseus [TaxId:4058]
    Gene: TDC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17770
      • conflict (400)
    Domains in SCOPe 2.07: d6eewa_
  • Chain 'B':
    Compound: Aromatic-L-amino-acid decarboxylase
    Species: Catharanthus roseus [TaxId:4058]
    Gene: TDC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17770
      • conflict (400)
    Domains in SCOPe 2.07: d6eewb_
  • Chain 'C':
    Compound: Aromatic-L-amino-acid decarboxylase
    Species: Catharanthus roseus [TaxId:4058]
    Gene: TDC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17770
      • conflict (400)
    Domains in SCOPe 2.07: d6eewc_
  • Chain 'D':
    Compound: Aromatic-L-amino-acid decarboxylase
    Species: Catharanthus roseus [TaxId:4058]
    Gene: TDC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17770
      • conflict (400)
    Domains in SCOPe 2.07: d6eewd_
  • Heterogens: TRP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eewA (A:)
    mgsidstnvamsnspvgefkpleaeefrkqahrmvdfiadyyknvetypvlsevepgylr
    kripetapylpeplddimkdiqkdiipgmtnwmspnfyaffpatvssaaflgemlstaln
    svgftwvsspaatelemivmdwlaqilklpksfmfsgtgggviqnttsesilctiiaare
    raleklgpdsigklvcygsdqthtmfpktcklagiypnnirlipttvetdfgispqvlrk
    mveddvaagyvplflcatlgttsttatdpvdslseianefgiwihvdaayagsacicpef
    rhyldgiervdslslsphkwllayldctclwvkqphlllralttnpeylknkqsdldkvv
    dfknwqiatgrkfrslklwlilrsygvvnlqshirsdvamakmfeewvrsdsrfeivvpr
    nfslvcfrlkpdvsslhveevnkklldmlnstgrvymthtivggiymlrlavgsslteeh
    hvrrvwdliqkltddllkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eewA (A:)
    fkpleaeefrkqahrmvdfiadyyknvetypvlsevepgylrkripetapylpeplddim
    kdiqkdiipgmtnwmspnfyaffpatvssaaflgemlstalnsvgftwvsspaatelemi
    vmdwlaqilklpksfmfsgtgggviqnttsesilctiiaareraleklgpdsigklvcyg
    sdqthtmfpktcklagiypnnirlipttvetdfgispqvlrkmveddvaagyvplflcat
    lgttsttatdpvdslseianefgiwihvdaayagsacicpefrhyldgiervdslslsph
    kwllayldctclwvkqphlllralttnpeylknkqsdldkvvdfknwqiatgrkfrslkl
    wlilrsygvvnlqshirsdvamakmfeewvrsdsrfeivvprnfslvcfrlkpdvsslhv
    eevnkklldmlnstgrvymthtivggiymlrlavgsslteehhvrrvwdliqkltddll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eewB (B:)
    mgsidstnvamsnspvgefkpleaeefrkqahrmvdfiadyyknvetypvlsevepgylr
    kripetapylpeplddimkdiqkdiipgmtnwmspnfyaffpatvssaaflgemlstaln
    svgftwvsspaatelemivmdwlaqilklpksfmfsgtgggviqnttsesilctiiaare
    raleklgpdsigklvcygsdqthtmfpktcklagiypnnirlipttvetdfgispqvlrk
    mveddvaagyvplflcatlgttsttatdpvdslseianefgiwihvdaayagsacicpef
    rhyldgiervdslslsphkwllayldctclwvkqphlllralttnpeylknkqsdldkvv
    dfknwqiatgrkfrslklwlilrsygvvnlqshirsdvamakmfeewvrsdsrfeivvpr
    nfslvcfrlkpdvsslhveevnkklldmlnstgrvymthtivggiymlrlavgsslteeh
    hvrrvwdliqkltddllkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eewB (B:)
    fkpleaeefrkqahrmvdfiadyyknvetypvlsevepgylrkripetapylpeplddim
    kdiqkdiipgmtnwmspnfyaffpatvssaaflgemlstalnsvgftwvsspaatelemi
    vmdwlaqilklpksfmfsgtgggviqnttsesilctiiaareraleklgpdsigklvcyg
    sdqthtmfpktcklagiypnnirlipttvetdfgispqvlrkmveddvaagyvplflcat
    lgttsttatdpvdslseianefgiwihvdaayagsacicpefrhyldgiervdslslsph
    kwllayldctclwvkqphlllralttndkvvdfknwqiatgrkfrslklwlilrsygvvn
    lqshirsdvamakmfeewvrsdsrfeivvprnfslvcfrlkpdvsslhveevnkklldml
    nstgrvymthtivggiymlrlavgsslteehhvrrvwdliqkltddll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eewC (C:)
    mgsidstnvamsnspvgefkpleaeefrkqahrmvdfiadyyknvetypvlsevepgylr
    kripetapylpeplddimkdiqkdiipgmtnwmspnfyaffpatvssaaflgemlstaln
    svgftwvsspaatelemivmdwlaqilklpksfmfsgtgggviqnttsesilctiiaare
    raleklgpdsigklvcygsdqthtmfpktcklagiypnnirlipttvetdfgispqvlrk
    mveddvaagyvplflcatlgttsttatdpvdslseianefgiwihvdaayagsacicpef
    rhyldgiervdslslsphkwllayldctclwvkqphlllralttnpeylknkqsdldkvv
    dfknwqiatgrkfrslklwlilrsygvvnlqshirsdvamakmfeewvrsdsrfeivvpr
    nfslvcfrlkpdvsslhveevnkklldmlnstgrvymthtivggiymlrlavgsslteeh
    hvrrvwdliqkltddllkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eewC (C:)
    fkpleaeefrkqahrmvdfiadyyknvetypvlsevepgylrkripetapylpeplddim
    kdiqkdiipgmtnwmspnfyaffpatvssaaflgemlstalnsvgftwvsspaatelemi
    vmdwlaqilklpksfmfsgtgggviqnttsesilctiiaareraleklgpdsigklvcyg
    sdqthtmfpktcklagiypnnirlipttvetdfgispqvlrkmveddvaagyvplflcat
    lgttsttatdpvdslseianefgiwihvdaayagsacicpefrhyldgiervdslslsph
    kwllayldctclwvkqphlllralttndkvvdfknwqiatgrkfrslklwlilrsygvvn
    lqshirsdvamakmfeewvrsdsrfeivvprnfslvcfrlkpdvsslhveevnkklldml
    nstgrvymthtivggiymlrlavgsslteehhvrrvwdliqkltddl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6eewD (D:)
    mgsidstnvamsnspvgefkpleaeefrkqahrmvdfiadyyknvetypvlsevepgylr
    kripetapylpeplddimkdiqkdiipgmtnwmspnfyaffpatvssaaflgemlstaln
    svgftwvsspaatelemivmdwlaqilklpksfmfsgtgggviqnttsesilctiiaare
    raleklgpdsigklvcygsdqthtmfpktcklagiypnnirlipttvetdfgispqvlrk
    mveddvaagyvplflcatlgttsttatdpvdslseianefgiwihvdaayagsacicpef
    rhyldgiervdslslsphkwllayldctclwvkqphlllralttnpeylknkqsdldkvv
    dfknwqiatgrkfrslklwlilrsygvvnlqshirsdvamakmfeewvrsdsrfeivvpr
    nfslvcfrlkpdvsslhveevnkklldmlnstgrvymthtivggiymlrlavgsslteeh
    hvrrvwdliqkltddllkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eewD (D:)
    fkpleaeefrkqahrmvdfiadyyknvetypvlsevepgylrkripetapylpeplddim
    kdiqkdiipgmtnwmspnfyaffpatvssaaflgemlstalnsvgftwvsspaatelemi
    vmdwlaqilklpksfmfsgtgggviqnttsesilctiiaareraleklgpdsigklvcyg
    sdqthtmfpktcklagiypnnirlipttvetdfgispqvlrkmveddvaagyvplflcat
    lgttsttatdpvdslseianefgiwihvdaayagsacicpefrhyldgiervdslslsph
    kwllayldctclwvkqphlllralttvvdfknwqiatgrkfrslklwlilrsygvvnlqs
    hirsdvamakmfeewvrsdsrfeivvprnfslvcfrlkpdvsslhveevnkklldmlnst
    grvymthtivggiymlrlavgsslteehhvrrvwdliqkltddl