PDB entry 6eeq

View 6eeq on RCSB PDB site
Description: Crystal structure of Rhodiola rosea 4-hydroxyphenylacetaldehyde synthase
Class: lyase
Keywords: Aromatic Amino Acid Decarboxylase, LYASE
Deposited on 2018-08-15, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylacetaldehyde synthase
    Species: Rhodiola rosea [TaxId:203015]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eeqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eeqA (A:)
    mgslpspndpsntfnpmdltelstesklvvdfitqyyqtletrpvqprvkpgfltgqlpd
    kapfhgesmevilsdvnekivpglthwqspnfhayfpasssnagllgellcsglsvigft
    wssspaatelenvvvdwmakmlnlpssfcfsgggggvlqantceavlctlaaardkalnr
    vgddqinklvlycsdqthftihkgakligirskniksittkkenefklcpndlrdairsd
    leaglvpfyvcgtigttalgvvdpikelgkvarefdlwlhvdgayggsacicpefqhyld
    gvdlvdsismnahkwllsnldccflwlqspnalieslaaeanflkggsemvdykdwqisl
    srrfraikmwmvirrygvsnliehirsdvsmavrfeemvaaddrfeivfprkfalvcfkl
    ssektppgrdseltrelmervnssgkaylsgvqmgriffircvigsslteerhvdnlwrl
    iqetaqsivs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eeqA (A:)
    npmdltelstesklvvdfitqyyqtletrpvqprvkpgfltgqlpdkapfhgesmevils
    dvnekivpglthwqspnfhayfpasssnagllgellcsglsvigftwssspaatelenvv
    vdwmakmlnlpssfcfsgggggvlqantceavlctlaaardkalnrvgddqinklvlycs
    dqthftihkgakligirskniksittkkenefklcpndlrdairsdleaglvpfyvcgti
    gttalgvvdpikelgkvarefdlwlhvdgayggsacicpefqhyldgvdlvdsismnahk
    wllsnldccflwlqspnalieslaaemvdykdwqislsrrfraikmwmvirrygvsnlie
    hirsdvsmavrfeemvaaddrfeivfprkfalvcfklssektppgrdseltrelmervns
    sgkaylsgvqmgriffircvigsslteerhvdnlwrliqetaqsivs