PDB entry 6eem

View 6eem on RCSB PDB site
Description: Crystal structure of Papaver somniferum tyrosine decarboxylase in complex with L-tyrosine
Class: lyase
Keywords: Aromatic Amino Acid Decarboxylase, LYASE
Deposited on 2018-08-14, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine/dopa decarboxylase
    Species: Papaver somniferum [TaxId:3469]
    Gene: tydc9
    Database cross-references and differences (RAF-indexed):
    • Uniprot O82415
      • conflict (44)
      • conflict (201)
      • conflict (347)
      • conflict (409)
      • conflict (433)
      • conflict (455)
    Domains in SCOPe 2.07: d6eema_
  • Chain 'B':
    Compound: Tyrosine/dopa decarboxylase
    Species: Papaver somniferum [TaxId:3469]
    Gene: tydc9
    Database cross-references and differences (RAF-indexed):
    • Uniprot O82415
      • conflict (44)
      • conflict (201)
      • conflict (347)
      • conflict (409)
      • conflict (433)
      • conflict (455)
    Domains in SCOPe 2.07: d6eemb_
  • Heterogens: 0PR, SO4, TYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eemA (A:)
    mgslptnnlesislcsqnpldpdefrrqghmiidfladyyknvekypvrsqvepgylkkr
    lpesapynpesietiledvtndiipglthwqspnyfayfpssgsiagflgemlstgfnvv
    gfnwmsspaatelesivmnwlgqmltlpksflfssdgssggggvlqgttceailctltaa
    rdkmlnkigreninklvvyasdqthcalqkaaqiaginpknvraiktskatnfglspnsl
    qsailadiesglvplflcatvgttsstavdpigplcavaklygiwvhidaayagsacicp
    efrhfidgvedadsfslnahkwffttldccclwvkdsdslvkalstspeylknkateskq
    vidykdwqialsrrfrsmklwlvlrsygvanlrtflrshvkmakhfqgligmdnrfeivv
    prtfamvcfrlkptaifkqkivdndyiedqtnevnvkllesvnasgkiymthavvggvym
    irfavgatlteerhvtgawkvvqehtdailga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eemA (A:)
    qnpldpdefrrqghmiidfladyyknvekypvrsqvepgylkkrlpesapynpesietil
    edvtndiipglthwqspnyfayfpssgsiagflgemlstgfnvvgfnwmsspaatelesi
    vmnwlgqmltlpksflfssdgggggvlqgttceailctltaardkmlnkigreninklvv
    yasdqthcalqkaaqiaginpknvraiktskatnfglspnslqsailadiesglvplflc
    atvgttsstavdpigplcavaklygiwvhidaayagsacicpefrhfidgvedadsfsln
    ahkwffttldccclwvkdsdslvkalstspeylknqvidykdwqialsrrfrsmklwlvl
    rsygvanlrtflrshvkmakhfqgligmdnrfeivvprtfamvcfrlkptaifkqkivdn
    dyiedqtnevnvkllesvnasgkiymthavvggvymirfavgatlteerhvtgawkvvqe
    htdailg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eemB (B:)
    mgslptnnlesislcsqnpldpdefrrqghmiidfladyyknvekypvrsqvepgylkkr
    lpesapynpesietiledvtndiipglthwqspnyfayfpssgsiagflgemlstgfnvv
    gfnwmsspaatelesivmnwlgqmltlpksflfssdgssggggvlqgttceailctltaa
    rdkmlnkigreninklvvyasdqthcalqkaaqiaginpknvraiktskatnfglspnsl
    qsailadiesglvplflcatvgttsstavdpigplcavaklygiwvhidaayagsacicp
    efrhfidgvedadsfslnahkwffttldccclwvkdsdslvkalstspeylknkateskq
    vidykdwqialsrrfrsmklwlvlrsygvanlrtflrshvkmakhfqgligmdnrfeivv
    prtfamvcfrlkptaifkqkivdndyiedqtnevnvkllesvnasgkiymthavvggvym
    irfavgatlteerhvtgawkvvqehtdailga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eemB (B:)
    qnpldpdefrrqghmiidfladyyknvekypvrsqvepgylkkrlpesapynpesietil
    edvtndiipglthwqspnyfayfpssgsiagflgemlstgfnvvgfnwmsspaatelesi
    vmnwlgqmltlpksflfssdgggggvlqgttceailctltaardkmlnkigreninklvv
    yasdqthcalqkaaqiaginpknvraiktskatnfglspnslqsailadiesglvplflc
    atvgttsstavdpigplcavaklygiwvhidaayagsacicpefrhfidgvedadsfsln
    ahkwffttldccclwvkdsdslvkalstspeylknkqvidykdwqialsrrfrsmklwlv
    lrsygvanlrtflrshvkmakhfqgligmdnrfeivvprtfamvcfrlkptaifkqkivd
    ndyiedqtnevnvkllesvnasgkiymthavvggvymirfavgatlteerhvtgawkvvq
    ehtdailg