PDB entry 6edx

View 6edx on RCSB PDB site
Description: Crystal Structure of SGK3 PX domain
Class: transferase
Keywords: PX domain, endosome, trafficking, sorting nexin, TRANSFERASE
Deposited on 2018-08-12, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Sgk3
    Species: Homo sapiens [TaxId:9606]
    Gene: SGK3, CISK, SGKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6edxa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6edxA (A:)
    gskescpsvsipssdehrekkkrftvykvlvsvgrsewfvfrryaefdklyntlkkqfpa
    malkipakrifgdnfdpdfikqrraglnefiqnlvrypelynhpdvraflqmdspkhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6edxA (A:)
    scpsvsipssdehrekkkrftvykvlvsvgrsewfvfrryaefdklyntlkkqfpamalk
    ipakrifgdnfdpdfikqrraglnefiqnlvrypelynhpdvraflqmdspkhq