PDB entry 6ec6

View 6ec6 on RCSB PDB site
Description: Ruminococcus gnavus Beta-glucuronidase
Class: hydrolase
Keywords: Glycosyl hydrolase, HYDROLASE
Deposited on 2018-08-07, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucuronidase
    Species: Ruminococcus gnavus [TaxId:33038]
    Gene: CDL23_04530, CDL24_00315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ec6a1, d6ec6a2, d6ec6a3
  • Chain 'B':
    Compound: beta-glucuronidase
    Species: Ruminococcus gnavus [TaxId:33038]
    Gene: CDL23_04530, CDL24_00315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ec6b1, d6ec6b2, d6ec6b3
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ec6A (A:)
    hhhhhhssgvdlgtenlyfqsnamleyselypiqnghrmmqsldgmwkfqfdpeeigeks
    gwenglpapvsmpvpssfadfftdhkerdycgdfwyetefylpaewrnkkiwlrfgsith
    rgtvycngmeitsheggflpvladistvakpgqvnqvvvkinnelnetslpcgatkilnn
    grklakpyfdffnysglqrsvwvialpeesvkdysvdyelcgtdalvkyevvttgehpvi
    vrlldaegelvaetegkegilqvanahlwevrnaylyqivilitdgngvldeyrekigir
    tvriegtqillndrpvylkgfgkhedfsilgrgfhwgivkrdfeclkwtnancfrtshyp
    yaeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiadt
    eemitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknskp
    elckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtdt
    maglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhkg
    vftrdrqpkaaavvfkdrwekknelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ec6A (A:)
    mleyselypiqnghrmmqsldgmwkfqfdpeeigeksgwenglpapvsmpvpssfadfft
    dhkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvla
    distvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwv
    ialpeesvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqv
    anahlwevrnaylyqivilitdvldeyrekigirtvriegtqillndrpvylkgfgkhed
    fsilgrgfhwgivkrdfeclkwtnancfrtshypyaeewyqfadeegfliidevpavgmm
    rstrnfvaagsgnytyffealtvpellkshiadteemitrdknhpsviawslfnepetit
    dyayeyfkevfaaaetydfqsrpmtgafeknskpelckcyplcdficlnryygwyisggp
    eieeaeelfrdemdrwkakelnvpfvftefgtdtmaglhklpsimwseeyqkeylemnfr
    vfdsyefvqgelawnfadfqttegimrvdgnhkgvftrdrqpkaaavvfkdrwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ec6B (B:)
    hhhhhhssgvdlgtenlyfqsnamleyselypiqnghrmmqsldgmwkfqfdpeeigeks
    gwenglpapvsmpvpssfadfftdhkerdycgdfwyetefylpaewrnkkiwlrfgsith
    rgtvycngmeitsheggflpvladistvakpgqvnqvvvkinnelnetslpcgatkilnn
    grklakpyfdffnysglqrsvwvialpeesvkdysvdyelcgtdalvkyevvttgehpvi
    vrlldaegelvaetegkegilqvanahlwevrnaylyqivilitdgngvldeyrekigir
    tvriegtqillndrpvylkgfgkhedfsilgrgfhwgivkrdfeclkwtnancfrtshyp
    yaeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiadt
    eemitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknskp
    elckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtdt
    maglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhkg
    vftrdrqpkaaavvfkdrwekknelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ec6B (B:)
    mleyselypiqnghrmmqsldgmwkfqfdpeeigeksgwenglpapvsmpvpssfadfft
    dhkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvla
    distvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwv
    ialpeesvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqv
    anahlwevrnaylyqivilitdgngvldeyrekigirtvriegtqillndrpvylkgfgk
    hedfsilgrgfhwgivkrdfeclkwtnancfrtshypyaeewyqfadeegfliidevpav
    gmmrstrnfvaagsgnytyffealtvpellkshiadteemitrdknhpsviawslfnepe
    titdyayeyfkevfaaaetydfqsrpmtgafeknskpelckcyplcdficlnryygwyis
    ggpeieeaeelfrdemdrwkakelnvpfvftefgtdtmaglhklpsimwseeyqkeylem
    nfrvfdsyefvqgelawnfadfqttegimrvdgnhkgvftrdrqpkaaavvfkdrwekkn