PDB entry 6ebz

View 6ebz on RCSB PDB site
Description: Crystal Structure of the Class Ie Riboucleotide Reductase Beta Subunit from Aerococcus urinae in Activated Form with Thiocyanate Bound
Class: oxidoreductase
Keywords: ribonucleotide reductase, beta subunit, RNR, R2, class Ie, metal-free, post-translational modification, PTM, DOPA, radical, SCN, thiocyanate, OXIDOREDUCTASE
Deposited on 2018-08-07, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase, beta subunit
    Species: Aerococcus urinae (strain ACS-120-V-Col10a) [TaxId:866775]
    Gene: HMPREF9243_0731
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2I8X9
      • see remark 999 (140)
    Domains in SCOPe 2.07: d6ebza_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase, beta subunit
    Species: Aerococcus urinae (strain ACS-120-V-Col10a) [TaxId:866775]
    Gene: HMPREF9243_0731
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2I8X9
      • see remark 999 (140)
    Domains in SCOPe 2.07: d6ebzb_
  • Chain 'C':
    Compound: Ribonucleoside-diphosphate reductase, beta subunit
    Species: Aerococcus urinae (strain ACS-120-V-Col10a) [TaxId:866775]
    Gene: HMPREF9243_0731
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2I8X9
      • see remark 999 (140)
    Domains in SCOPe 2.07: d6ebzc_
  • Chain 'D':
    Compound: Ribonucleoside-diphosphate reductase, beta subunit
    Species: Aerococcus urinae (strain ACS-120-V-Col10a) [TaxId:866775]
    Gene: HMPREF9243_0731
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2I8X9
      • see remark 999 (140)
  • Heterogens: DAH, CA, GOL, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ebzA (A:)
    mgsshhhhhhssglvprgstknyydrsvspveyayfdqsqnmrainwnkivdekdlevwn
    rvtqnfwlpenipvsndlpswneldddwqqlitrtftgltlldtvqssigdvaqiknslt
    eqeqviyanfafmvgvharsfgtifstlctseqieeahewvvdnealqarpkalipfyta
    ddplkskiaaalmpgfllyggfylpfylsargklpntsdiirlilrdkvihnfysgykyq
    lkvaklspekqaemkqfvfdlldkmiglektylhqlydgfgladeairfslynagkflqn
    lgyespftkeetriapevfaqlsaradenhdffsgsgssyiigtseetldedwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebzA (A:)
    nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
    neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsf
    gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
    fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
    ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
    lsaradenhdff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ebzB (B:)
    mgsshhhhhhssglvprgstknyydrsvspveyayfdqsqnmrainwnkivdekdlevwn
    rvtqnfwlpenipvsndlpswneldddwqqlitrtftgltlldtvqssigdvaqiknslt
    eqeqviyanfafmvgvharsfgtifstlctseqieeahewvvdnealqarpkalipfyta
    ddplkskiaaalmpgfllyggfylpfylsargklpntsdiirlilrdkvihnfysgykyq
    lkvaklspekqaemkqfvfdlldkmiglektylhqlydgfgladeairfslynagkflqn
    lgyespftkeetriapevfaqlsaradenhdffsgsgssyiigtseetldedwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebzB (B:)
    nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
    neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsf
    gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
    fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
    ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
    ls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ebzC (C:)
    mgsshhhhhhssglvprgstknyydrsvspveyayfdqsqnmrainwnkivdekdlevwn
    rvtqnfwlpenipvsndlpswneldddwqqlitrtftgltlldtvqssigdvaqiknslt
    eqeqviyanfafmvgvharsfgtifstlctseqieeahewvvdnealqarpkalipfyta
    ddplkskiaaalmpgfllyggfylpfylsargklpntsdiirlilrdkvihnfysgykyq
    lkvaklspekqaemkqfvfdlldkmiglektylhqlydgfgladeairfslynagkflqn
    lgyespftkeetriapevfaqlsaradenhdffsgsgssyiigtseetldedwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebzC (C:)
    nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
    neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsf
    gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
    fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
    ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
    lsa
    

  • Chain 'D':
    No sequence available.