PDB entry 6ebo

View 6ebo on RCSB PDB site
Description: Crystal Structure of the Class Ie Riboucleotide Reductase Beta Subunit from Aerococcus urinae in Unactivated Form
Class: oxidoreductase
Keywords: ribonucleotide reductase, beta subunit, RNR, R2, class Ie, metal-free, OXIDOREDUCTASE
Deposited on 2018-08-06, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase, beta subunit
    Species: Aerococcus urinae (strain ACS-120-V-Col10a) [TaxId:866775]
    Gene: HMPREF9243_0731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eboa_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase, beta subunit
    Species: Aerococcus urinae (strain ACS-120-V-Col10a) [TaxId:866775]
    Gene: HMPREF9243_0731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ebob_
  • Chain 'C':
    Compound: Ribonucleoside-diphosphate reductase, beta subunit
    Species: Aerococcus urinae (strain ACS-120-V-Col10a) [TaxId:866775]
    Gene: HMPREF9243_0731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eboc_
  • Chain 'D':
    Compound: Ribonucleoside-diphosphate reductase, beta subunit
    Species: Aerococcus urinae (strain ACS-120-V-Col10a) [TaxId:866775]
    Gene: HMPREF9243_0731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ebod_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eboA (A:)
    mgsshhhhhhssglvprgstknyydrsvspveyayfdqsqnmrainwnkivdekdlevwn
    rvtqnfwlpenipvsndlpswneldddwqqlitrtftgltlldtvqssigdvaqiknslt
    eqeqviyanfafmvgvharsygtifstlctseqieeahewvvdnealqarpkalipfyta
    ddplkskiaaalmpgfllyggfylpfylsargklpntsdiirlilrdkvihnfysgykyq
    lkvaklspekqaemkqfvfdlldkmiglektylhqlydgfgladeairfslynagkflqn
    lgyespftkeetriapevfaqlsaradenhdffsgsgssyiigtseetldedwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eboA (A:)
    nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
    neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsy
    gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
    fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
    ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
    lsaradenhdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eboB (B:)
    mgsshhhhhhssglvprgstknyydrsvspveyayfdqsqnmrainwnkivdekdlevwn
    rvtqnfwlpenipvsndlpswneldddwqqlitrtftgltlldtvqssigdvaqiknslt
    eqeqviyanfafmvgvharsygtifstlctseqieeahewvvdnealqarpkalipfyta
    ddplkskiaaalmpgfllyggfylpfylsargklpntsdiirlilrdkvihnfysgykyq
    lkvaklspekqaemkqfvfdlldkmiglektylhqlydgfgladeairfslynagkflqn
    lgyespftkeetriapevfaqlsaradenhdffsgsgssyiigtseetldedwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eboB (B:)
    nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
    neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsy
    gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
    fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
    ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
    lsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eboC (C:)
    mgsshhhhhhssglvprgstknyydrsvspveyayfdqsqnmrainwnkivdekdlevwn
    rvtqnfwlpenipvsndlpswneldddwqqlitrtftgltlldtvqssigdvaqiknslt
    eqeqviyanfafmvgvharsygtifstlctseqieeahewvvdnealqarpkalipfyta
    ddplkskiaaalmpgfllyggfylpfylsargklpntsdiirlilrdkvihnfysgykyq
    lkvaklspekqaemkqfvfdlldkmiglektylhqlydgfgladeairfslynagkflqn
    lgyespftkeetriapevfaqlsaradenhdffsgsgssyiigtseetldedwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eboC (C:)
    nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
    neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsy
    gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
    fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
    ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
    lsara
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6eboD (D:)
    mgsshhhhhhssglvprgstknyydrsvspveyayfdqsqnmrainwnkivdekdlevwn
    rvtqnfwlpenipvsndlpswneldddwqqlitrtftgltlldtvqssigdvaqiknslt
    eqeqviyanfafmvgvharsygtifstlctseqieeahewvvdnealqarpkalipfyta
    ddplkskiaaalmpgfllyggfylpfylsargklpntsdiirlilrdkvihnfysgykyq
    lkvaklspekqaemkqfvfdlldkmiglektylhqlydgfgladeairfslynagkflqn
    lgyespftkeetriapevfaqlsaradenhdffsgsgssyiigtseetldedwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eboD (D:)
    nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
    neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsy
    gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
    fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
    ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
    lsaradenhdf