PDB entry 6e9g

View 6e9g on RCSB PDB site
Description: The crystal structure of bovine ultralong antibody BOV-2
Class: immune system
Keywords: B-lymphocytes, antigen-antibody reactions, antibodies, monoclonal, antibody diversity, Bos taurus, IMMUNE SYSTEM
Deposited on 2018-08-01, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bovine ultralong antibody BOV-2 heavy chain
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6E9G
  • Chain 'B':
    Compound: Bovine ultralong antibody BOV-2 light chain
    Species: Bos taurus [TaxId:9913]
    Gene: IGL@
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3T101
      • conflict (4)
      • conflict (80)
    Domains in SCOPe 2.07: d6e9gb1, d6e9gb2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e9gB (B:)
    eavlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvp
    drfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvt
    lfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaass
    ylsltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e9gB (B:)
    avlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpd
    rfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvtl
    fppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassy
    lsltssdwkskgsyscevthegstvtktvkpsec