PDB entry 6e7d

View 6e7d on RCSB PDB site
Description: Structure of the inhibitory NKR-P1B receptor bound to the host-encoded ligand, Clr-b
Class: immune system
Keywords: Natural Killer cell receptor, C-type lectin related ligand, immune complex, innate immunity, IMMUNE SYSTEM
Deposited on 2018-07-26, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (Start-121)
      • expression tag (122-123)
    Domains in SCOPe 2.07: d6e7da1, d6e7da2
  • Chain 'B':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6e7db_
  • Chain 'C':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (Start-121)
      • expression tag (122-123)
    Domains in SCOPe 2.07: d6e7dc1, d6e7dc2
  • Chain 'D':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (Start-121)
      • expression tag (122-123)
    Domains in SCOPe 2.07: d6e7dd1, d6e7dd2
  • Chain 'E':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (1-121)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6e7de_
  • Chain 'F':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (1-121)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6e7df_
  • Chain 'G':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (Start-121)
      • expression tag (122)
    Domains in SCOPe 2.07: d6e7dg1, d6e7dg2
  • Chain 'H':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (1-121)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6e7dh_
  • Chain 'I':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (Start-121)
      • expression tag (122)
    Domains in SCOPe 2.07: d6e7di1, d6e7di2
  • Chain 'J':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (1-121)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6e7dj_
  • Chain 'K':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (Start-121)
      • expression tag (122-123)
    Domains in SCOPe 2.07: d6e7dk1, d6e7dk2
  • Chain 'L':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (1-121)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6e7dl_
  • Chain 'M':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (Start-121)
      • expression tag (122)
    Domains in SCOPe 2.07: d6e7dm1, d6e7dm2
  • Chain 'N':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (1-121)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6e7dn_
  • Chain 'O':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (Start-121)
      • expression tag (122-123)
    Domains in SCOPe 2.07: d6e7do1, d6e7do2
  • Chain 'P':
    Compound: C-type lectin domain family 2 member D
    Species: Mus musculus [TaxId:10090]
    Gene: Clec2d, Clrb, Ocil
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91V08 (1-121)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6e7dp_
  • Chain 'Q':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4
      • engineered mutation (31)
    Domains in SCOPe 2.07: d6e7dq_
  • Chain 'R':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4
      • engineered mutation (31)
    Domains in SCOPe 2.07: d6e7dr_
  • Chain 'S':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4 (Start-128)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d6e7ds_
  • Chain 'T':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4 (Start-128)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d6e7dt_
  • Chain 'U':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4
      • engineered mutation (31)
    Domains in SCOPe 2.07: d6e7du_
  • Chain 'V':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4
      • engineered mutation (31)
    Domains in SCOPe 2.07: d6e7dv_
  • Chain 'W':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4 (Start-128)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d6e7dw_
  • Chain 'X':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4
      • engineered mutation (31)
    Domains in SCOPe 2.07: d6e7dx_
  • Heterogens: SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e7dA (A:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dA (A:)
    tyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfd
    swiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsklna
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e7dB (B:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dB (B:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    l
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e7dC (C:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dC (C:)
    yaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfds
    wiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsklnas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6e7dD (D:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dD (D:)
    tyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfd
    swiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsklna
    s
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6e7dE (E:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dE (E:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    ln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6e7dF (F:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dF (F:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    ln
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6e7dG (G:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dG (G:)
    yaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfds
    wiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsklna
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6e7dH (H:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dH (H:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    ln
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6e7dI (I:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dI (I:)
    yaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfds
    wiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsklna
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6e7dJ (J:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dJ (J:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    ln
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6e7dK (K:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dK (K:)
    acpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfdswi
    glhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsklnas
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6e7dL (L:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dL (L:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    ln
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6e7dM (M:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dM (M:)
    yaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfds
    wiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsklna
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6e7dN (N:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dN (N:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    ln
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6e7dO (O:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dO (O:)
    acpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmrykanfdswi
    glhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsklnas
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6e7dP (P:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    lnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dP (P:)
    mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka
    nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk
    ln
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6e7dQ (Q:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dQ (Q:)
    klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
    sfwiglsytnwkwingtafnsditgvtengscaaisgekvtsegcssdnrwicqkel
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6e7dR (R:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dR (R:)
    pqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekynsfwi
    glsymnwkwingtafnsditgvtegscaaisgekvtsegcssdnrwicqkel
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6e7dS (S:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dS (S:)
    klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
    sfwiglsytltdmnwkwingtafnsditgvtengscaaisgekvtsegcssdnrwicqke
    ln
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6e7dT (T:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dT (T:)
    klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
    sfwiglsytltdmnwkwingtafnskitgvtengscaaisgekvtsegcssdnrwicqke
    ln
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6e7dU (U:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dU (U:)
    cpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekynsfw
    iglsytltdmnwkwingtafnsditgvtengscaaisgekvtsegcssdnrwicqk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >6e7dV (V:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dV (V:)
    klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
    sfwiglsytltdmnwkwingtafnsditgvtengscaaisgekvtsegcssdnrwicqke
    l
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >6e7dW (W:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dW (W:)
    klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
    sfwiglsytltdmnwkwingtafnsdtgvtscaaisgekvtsegcssdnrwicqkeln
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6e7dX (X:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7dX (X:)
    klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
    sfwiglsytltdmnwkwingtafnstgvtengscaaisgekvtsegcssdnrwicqkel